SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028277 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028277
Domain Number 1 Region: 233-525
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 5.1e-96
Family Cryptochrome/photolyase FAD-binding domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 41-250
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 4.71e-34
Family Cryptochrome/photolyase, N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028277   Gene: ENSBTAG00000021223   Transcript: ENSBTAT00000028277
Sequence length 610
Comment pep:known_by_projection chromosome:UMD3.1:15:76753525:76790450:1 gene:ENSBTAG00000021223 transcript:ENSBTAT00000028277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQARGAYGGGAVAARAVRAVMAAAAAAATQAPAARGDGASSVHWFRKGLRLHDNPALLAA
VRGAHCVRCVYILDPWFAASSSVGINRWRRYVKQGVEIKETVLRKTSGNLVSCWKVPSSD
SLPQQEWGVTRLTFEYDSEPFGKERDTAIMKMAKEAGVEVVTENSHTLYDLDKIIELNGQ
KPPLTYKRFQAIISRMELPRKPVGSVTSQQMEGCRAEIQESHDETYGVPSLEELGFPTEG
LGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRL
FYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNP
EALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDEL
LLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYI
YEPWNAPESIQKAAKCVIGVDYPRPIVNHAEASRLNIERMKQVYQQLSRYRGLCLLASVP
SCVEDLSNPVAEPSSIQAGSSSSVGPRPLPGGPASPKRKLEAAEEPPGGELSKRARVAES
LPSELPSRGV
Download sequence
Identical sequences F1N0J9
ENSBTAP00000028277 ENSBTAP00000028277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]