SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030047 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030047
Domain Number 1 Region: 42-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-27
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030047   Gene: ENSBTAG00000008502   Transcript: ENSBTAT00000030060
Sequence length 107
Comment pep:novel chromosome:UMD3.1:18:49711779:49714686:1 gene:ENSBTAG00000008502 transcript:ENSBTAT00000030060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMGNEERLRDCALERNVNCLLYCLFPTKQSSPFENTEYMGLSFQMSLSFRDVAIDLSQEE
WECLDPVQRALYRDVMLENYSNLVSLGCSTPKPDMITLLEQEKEPWM
Download sequence
Identical sequences E1BN88
ENSBTAP00000030047 ENSBTAP00000030047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]