SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031529 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031529
Domain Number 1 Region: 158-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-43
Family MAM domain 0.001
Further Details:      
 
Domain Number 2 Region: 601-759
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-35
Family MAM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 384-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-34
Family MAM domain 0.0056
Further Details:      
 
Domain Number 4 Region: 1099-1262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-30
Family MAM domain 0.00073
Further Details:      
 
Domain Number 5 Region: 5-110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-19
Family MAM domain 0.016
Further Details:      
 
Domain Number 6 Region: 557-596
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1315-1353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 8 Region: 1056-1091
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 340-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 1274-1312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 11 Region: 774-813
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 12 Region: 813-856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000214
Family MAM domain 0.024
Further Details:      
 
Domain Number 13 Region: 122-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 14 Region: 1357-1394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000124
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 15 Region: 917-974
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000348
Family MAM domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031529   Gene: ENSBTAG00000023216   Transcript: ENSBTAT00000031578
Sequence length 1395
Comment pep:novel chromosome:UMD3.1:13:21049546:21386152:1 gene:ENSBTAG00000023216 transcript:ENSBTAT00000031578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFILKKSNSLSQIARLQSPTFSQTGPGCTLSFWFYNYGLSVGAAELQLHVGNSSESTVLW
RVLYNQGDQWSRAVVQLGRLTQPFHLLLHKVSLGIYVGVSAIDDIRFENCLLPPPSKSCK
EPDHFWCLHTRICVKKLQLCDLVDDCGDYTDEVNCVPELQCNFENGICNWEQDTEDDFDW
TRYQGPTSTLNTGPMKDNTLGTAQGHYLYIESSEPQVFQHRAALLSPILNATDAEGCTFR
LYYHMFGKHIYRLAVYQRVWNNTRGQLLWHIFGNQGPIWIRKSLNLFSRKPFQISVEASV
GDGFTGDIAIDDLSFMDCTLYPGHLPVNLPTPPETTVPVTLPPHNCADSEFVCRSDGQCV
ENIQKCDFRYDCPDQSDESSCAMDICSFEKGSLCKWYQPISEKLIKDSNTFRWGLGNGTS
IHHGEENHRPSVDHTTNTADGWYLYADSSNGNFGDIADILTPVISHTGPKCTLVFWTHMN
GATVGSLQVLSKKDNVTSKLWAQSGQQGAQWKKVELFLGVHSHIQIVFRAKRGISYIGDV
AVDDISFQDCSPLLSADRTCTAQEFTCANKHCIAKDKLCDFVNDCADNSDETPFICGASR
GRCDFEFDLCSWEQEQDDDFDWNLKASNVPATGTEPAADHTLGNSSGHYIFIKSLFPQQP
MRAARISSPVISWRSKNCKIIFHYHMYGHGIGALTLIQVSVSNQTKVLLNLTVEQGNFWQ
RKELALSGDEDFQLKFEGRVGKGHRGDIALDDIVLTKNCLSSHHSMKEELAVPLPTGYCP
LGYRECQNGRCFTPEQSCNFVDDCGDYTDENECGGSCTFEKGWCGWQNSLAENFDWILGV
GSPQSLRPPRDHTLENENAVSLSPWHKYSVRSVHLRTVKYLKAQTFGNCSVSELEARLLD
FLSLSSRNTFGRHDLNLILFPGHFLYLEATPVGLRGEEAHLKSGLWQESSASCTMSFWYF
ISTKATGSIQILIKKLMKGRKSYFVPHTALNANCSVPRLISNYLMNWISNKFNNRRRNFP
KGKCQKGKKNMVHGPVKEKQNRIYHLLKMGETSEICPEATDFLCHNKKCIASHLVCDYKP
DCSDGSDEAHCGQYTGTAGSCSFETTSGNWTTTCHLTQDSQDDLDWAIGSGIPTEALSPD
PDHTPGSGQHFLFVNSSGPKEGYTARITTSQYFPASLGMCAVRFWFYMVDPGSTGVLKVY
TVDESGLNILMWSVIGNKRTGWMYGHVPLSSNSPFKVAFEADLSGKQNIFIALDDISFTP
ECVFGGLVTVQPSLCEADQFSCIYVVQCVPLAGKCNGQEDCTDGSDEMDCPISPLPQLCG
QTEFQCSTHECIPSLLLCDGVPDCYFNEDESGCSDKSCSHGALTCSSSNSCIPLHKRCDG
FADCMDFQPDESSCL
Download sequence
Identical sequences F1MFJ4
ENSBTAP00000031529 ENSBTAP00000031529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]