SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033006 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033006
Domain Number 1 Region: 414-605
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-38
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 197-402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.45e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 609-789
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 6-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-33
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 815-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000035
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033006   Gene: ENSBTAG00000024021   Transcript: ENSBTAT00000033082
Sequence length 851
Comment pep:known chromosome:UMD3.1:11:32715365:32880569:-1 gene:ENSBTAG00000024021 transcript:ENSBTAT00000033082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKN
GAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTIS
VDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRL
ELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRT
TEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKV
NDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTE
VWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSNPCKNNGM
CRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQR
AYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWH
TVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQ
SLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLF
FQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHN
VMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQ
GCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCS
MTSFSGPLCND
Download sequence
Identical sequences F1MT47 G1PAE5
ENSBTAP00000033006 ENSBTAP00000026956 ENSMLUP00000007252 ENSMLUP00000007252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]