SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033692 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033692
Domain Number 1 Region: 538-570,651-727
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033692   Gene: ENSBTAG00000010062   Transcript: ENSBTAT00000033783
Sequence length 782
Comment pep:known_by_projection chromosome:UMD3.1:4:48956493:49014467:1 gene:ENSBTAG00000010062 transcript:ENSBTAT00000033783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGDRLEPPPLPEYSCSYVVSRPVYNELAFQQQYEQRPKERKTLRENLAQGCSCSRKR
TLRMVKTLLPILDWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFLVSSSNGTALNTTIIDFAA
RDAARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGILSIIYTLIEIFQNISNTNLADFIAGLLTIIICMAVKELNDRFKHKIPVPI
PIEVIVTIAATAISYGVDLEKKYNAGIVKSIPSGFLPPAMPSVSLFSEMLTASFSISVVA
YAIAVSVGKVYAIRHDYTIDGNQEFIAFGISNIFSGLFSCFVATTALSRTAVQESTGGKT
QVAGIISAGVVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPHLWRQNKTDAV
IWVFTCMASIILGLDLGLLAGLVFGFLTVVLRVQFPSWNSLGSIPSTDIYKSTKNYKNIE
ELEGVKILRFSSPIFYGNVDGLKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIISGAGSSNNAFEPDEDIENPEEPDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRVIVKEFQRIDVNVYFASLQEDHVIEKLEKCGFFNDNNIRKDIF
FMTVHDAVLHLQNQVKSQEVQDSILETITLIQDCKDPLELMEAEMIEEQLDVQDEAIRRL
AS
Download sequence
Identical sequences E1BMB2
9913.ENSBTAP00000033692 ENSBTAP00000033692 ENSBTAP00000033692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]