SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053016 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053016
Domain Number 1 Region: 75-134
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-25
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053016   Gene: ENSBTAG00000040336   Transcript: ENSBTAT00000056095
Sequence length 148
Comment pep:known chromosome:UMD3.1:17:45191289:45218103:1 gene:ENSBTAG00000040336 transcript:ENSBTAT00000056095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRVRTAAIWVPPLQERDSSCNVSRKLQSEKSILDQGTPDQKPLSGGPWQRPRRPGVLE
WLLISQDQPKAKKSWGPLSFMDVFVDFTWEEWQLLDSAQKHLYRSVMLENFRNLVSLGYQ
YTKPSIIFQLEQEELWMMHSPSQGHSGE
Download sequence
Identical sequences A4IFT8
NP_001077115.1.59421 NP_001077115.1.76553 ENSBTAP00000053016 9913.ENSBTAP00000053016 ENSBTAP00000053016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]