SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053585 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053585
Domain Number 1 Region: 909-1200
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.54e-87
Family Complement components 0.0000174
Further Details:      
 
Domain Number 2 Region: 1281-1409
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.96e-31
Family Alpha-macroglobulin receptor domain 0.0018
Further Details:      
 
Domain Number 3 Region: 744-796
Classification Level Classification E-value
Superfamily E set domains 0.00000000238
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053585   Gene: ENSBTAG00000013222   Transcript: ENSBTAT00000061271
Sequence length 1447
Comment pep:known_by_projection chromosome:UMD3.1:9:13421249:13551857:1 gene:ENSBTAG00000013222 transcript:ENSBTAT00000061271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLRLLTAARLFCVWSAALAAVPGPRFLVTVPGIIRPGGNVTIGVELLEHSPSQVTVKA
ELRKMAANRTVSVLEAEGVFEKGSFKTLILPSLPLNSADEMYELRVTGRAQDEILFSNST
RLSFETKRMTVFIQTDKPLYKPKQEVKFRVVTLFSDFKPYKTFLNILIKDPKSNLIQQWL
SEKSDLGVVSKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPRSAVLLRLPQSPQ
PPTSSTAGSVSLWYTYGKPVKGDLTLTFLPLSFWGVKKNITKTLKINGSANFSFNDEEMK
KVMDFSDGPSEYMYLSSPGPVEIIATVTESLTGISRNASSNVFFKQHDYIIEFFDYATVL
KPSLNFTATVKVTRSDGHQLTPEERRNNVVLMVTQRNYTEYWSRWDTQNQEVGAVQIINH
TVPANGIFKIEFPILDDSSELQLQASFLDSVSNMAVHGMFKSPSKTYIQLKVKDENIKVG
SPFELVVIGNKQLKELSYMVVSRGQLVAVGKQNSTTFSLIPENSWAPKACIIVYYIEDDG
EIINDVLKIPVQLVFKNKIQLFWSKANAEPSEKVSLRISVTQPDSTVGIVAVDKSVNLMN
VSNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLVKDYIDGVYDSVEL
AERFVDENEGYLVDIHDFSLGSSPRVRKHFPETWIWLDTNMGYRLKIYQEFEVTVPDSIT
SWVATAFVISEDLGLGLTTAPVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDAT
EVKVIIEKSDAFDILMASNEINATGHQQTILVPSEDGATVLFPIRPTRLGEVPITVTAVS
PAASDAVTQRILVKAEGIEKSYSQSILLDLTDSTLQTTLKTLSFSFPPHTVSGSERVQVT
AIGDILGSSINGLASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTENLKEKALSFMR
QGYQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLK
GHQKSNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNIDVQESINFLESE
FDRGISDNYTLALVTYALSSGRSPKAKEALDMLTWRAEQEGGLQFWVSLVSRLSESWQPS
SLDIEVAAYALLSHFLQHRVPEGIPIMRWLSRQRNSLGGFASTQDTIVALKALSEFAALM
NVEETNIQVTVEGSGSLSPVKFVIDTQNRFLLQTAELAVVQPTTVNISANGFGYAICQLN
VIYNVKNSRSSKSRRSIQDQESFDLDVAVKDNKDDVNHLDLNVCTRFLGPARSGMALMEV
NLLSGFTVSSDAIPLSDTLKKVEHDHGKLNLYLDSVNETQFCVDIPAVRSFRVSNTQDAS
VSIVDYYEPRRRAVRSYNSRAQLTSCDLCGDALACGPCDLAAAAHLPRLTAGLLLLCLAL
LFLQRWP
Download sequence
Identical sequences F1MPE1
ENSBTAP00000053585 ENSBTAP00000053585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]