SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053611 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053611
Domain Number 1 Region: 889-1024
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.33e-19
Family cAMP-binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 637-752
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000942
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053611   Gene: ENSBTAG00000019332   Transcript: ENSBTAT00000061361
Sequence length 1137
Comment pep:known_by_projection chromosome:UMD3.1:1:57360423:57501871:-1 gene:ENSBTAG00000019332 transcript:ENSBTAT00000061361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMDGQISNLTFHRKEFTDEWLEVFRHSFLETSQELPKIILILSLICMIGALLNQHLKDFP
IPLPVILFLLGCSFEMLSFTSDKVQEYADAIQWMDSHLFFNLFTPVIIFSVAFDMDVYLL
HKLFWQIVFITVPGFLINYTLILWYLASVNKLLLKTTPWLLFSAILVSLDPMLTSSAIKD
LGLSRSLVSLINGESLMTSVMSLITFTVIVNIDLSLHKNTIQSLAYIIMREIWLHLIVSF
SFGIVSSKLIQLWMSTVFGEDVNHISLSFSFLYLIFYICKKIGELTEMSGTFTLVIMGLF
LNSTNFKPGVEALILEFWNCLSFVAFLMVFTFTGLLIPAHTYLYISFSDIYYSLNIYLTL
IMFRLLVFLLLSPLLSRLGHGFSWRWAFIMVWSEMKGTPNINLALLLAYFENSYGSEREK
SQILFHGVSVSLISLIVNRFILPMAVTKLGLRDVTSTKYKSLYYTFQHFQELTKSVASAL
KFDRDLANADWNIVEKTIILQNPYALGQGETKEHQKVKCQHCNKEIDDNLNIEAMELANR
RLLSAQIASYQRQYRSETLSQSAIQVLVGAAGSFGEKMVEYMNAETIKNYSESKKILVFT
RKVLLNWVYNTKKEKGIPSSRHCFLRACHKIVFTDEFEYIGYLVILMNMFPIIISCISVL
NDIYETELAYANYSFLAFYIMEALLKIAAMRKEYFFHAWNLFELTITLVGIIDVMLIETN
SINYYIFDLVQIVIIMKIVRFLRILRILKLVTPRLLQILDKRMSHQLSFRYAILKGYVQG
EADIMTIIDKIASSKQVKQMLLRRVTKNTGHAMKELGYLEYDHPEIAVTMKTKEEINVML
SLAREIVKVFRLKGILHKIEGSEINKIIMAKKRDILDFQPTYKPLTVEEALYHIPWLDKD
EEHISFIQERSRVVTFDCGNDIFEEGDEPKGIYVIISGMVKLQRSKPGLGIDQIIWESEE
KDYQITYTDFVISGAVIGELNCLTNAPMKYSATCKTVVETCFIPKNHLYEAFEQFYPHIE
YRMWLKLGLSITAKKIREHLSYEDWNYKMQLKLSNIYVKDIPKNTKTDIYDETVIYVILN
MSSGKEILIHIFSKRIFYATMTDKCLQIQGTEDFTKVTIVQTSIYSKRFRWNTRKYI
Download sequence
Identical sequences F1MQF9
ENSBTAP00000053611 ENSBTAP00000053611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]