SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053730 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053730
Domain Number 1 Region: 138-185
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.01e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053730   Gene: ENSBTAG00000044113   Transcript: ENSBTAT00000061471
Sequence length 199
Comment pep:known chromosome:UMD3.1:18:56811617:56830129:-1 gene:ENSBTAG00000044113 transcript:ENSBTAT00000061471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGMEGPFFRDYALNAFVGRVGIDRLDLVASFVKNQTSNLMANSLRDEPLLDELVTLRERV
IKELKKVLRSYELKACDPKICRLLKEEVLDCLHCQMISPKCIREKYCFIALWTQAWSFLL
EMHSWDPAMAIRTLTSKGQESVTFKDVAVDFTLEEWGRLGPGQRELYRDVMLENYQNLLS
LGEALPPAVLSWPLCPPTA
Download sequence
Identical sequences E1BC82
ENSBTAP00000053730 ENSBTAP00000053730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]