SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054664 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054664
Domain Number 1 Region: 817-951,1011-1077
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-39
Family Hemopexin-like domain 0.00077
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000011
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000196
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054664   Gene: ENSBTAG00000011932   Transcript: ENSBTAT00000064366
Sequence length 1077
Comment pep:known chromosome:UMD3.1:16:68870182:68886786:1 gene:ENSBTAG00000011932 transcript:ENSBTAT00000064366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKILPIYLLLFSVFLIQQASSQDLSSCAGRCGEGYSRDAICNCDYNCQHYTECCPDFK
KECTVELSCKGRCFETFARGRECDCDSDCKKYGKCCSDYGTFCEAVHNPTTPPPPKTAPP
PPGASQTIKSTTKRSPKSPNKKKIKKVIESEEITEEHSVSENQESSSSSSSSSSTIRKIK
SSKNSAANRELKKKPKVKDKKKRTPKNKPTPEPPVIDEDGSGLDNGDFKLTPTPNIPTTQ
RNKVTTTPKITTVKPTLPKPSLPPNSDTTKEIPSTVNRETTVETKETSTTNKPTSTSAKE
KTTSAKETRTAENTSTKGLAPTPEVPAISTPKAETITRSPTPTTPKEPAPTTKEPALTTT
TKEPASTTPKKPAPTTPKETAPTTKEPEPTTKEPEPTTPKQPAPTTPKEPAPTTPKETAP
TTKEPAPTTPKEPAPTTPKEPAPTTTKEPAPTTPKEPAPTTPKEPESPTTPKEPAPTTPK
EPTPTTPKEPAPTTPKEPAPTTPKEPTPTTPKEPAPTTTPKEPAPTTKEPEPTTKEPAPT
TTTKEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAPTSPKEPAPTSPKEPAPTSP
KEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTTPKEPAPTDPK
EPAPAEPKEPAPTSPKEPAPTTTTKEPAPVTTPKPQKPTKAPKKPTSTKKPRTPRVRKPK
TTPTPPKTTTSAMPEPTPTSLPEAMLQTTTRPTPTPNSEIIDVNPENEDGDAAEGEKPHM
IFRPPVLTPIVIPGTEIIVRGPSQGFGINPMFSDETNLCNGRPVDGLTTLRNGTLVAFRG
HYFWMLTPFTPPPPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKGSQYWRFTNDIKDAG
YPKLISKGFGGLNGKIVAALSIAQYKSRPESVYFFKRGGSVQQYTYKQEPTQKCTGRRPA
INYSVYGETAQVRRRRFERAIGPSQVHTIRIHYTPVRVPYQDKGFLHNEVKVSTLWRGLP
NVVTSAISLPNIRKPDGYDYYALSKDQYYNIDVPSRTARAITTRSGQTLSNTWYNCP
Download sequence
Identical sequences G3MYM8
ENSBTAP00000054664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]