SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054781 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054781
Domain Number 1 Region: 226-363
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.74e-33
Family Prokaryotic proteases 0.0000109
Further Details:      
 
Domain Number 2 Region: 375-470
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-18
Family HtrA-like serine proteases 0.0019
Further Details:      
 
Domain Number 3 Region: 45-109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.0036
Further Details:      
 
Domain Number 4 Region: 95-143
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000368
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054781   Gene: ENSBTAG00000047613   Transcript: ENSBTAT00000065550
Sequence length 473
Comment pep:known_by_projection chromosome:UMD3.1:6:119387684:119418513:1 gene:ENSBTAG00000047613 transcript:ENSBTAT00000065550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASKPYTLLKLTSKGAATPPSAKAGDSGAEALPGGLSPESPQEGRCPPRPPVXCPGGYVP
DLCNCCLVCAATEGEPCGRPVDSPCGESLECVRGLCRCRWANAVCGTDGHTYANVCALQA
ASRRALQLSGTPVRQLQKGACPSASAGLHQLTSPRYKFNFIADVVEKIAPAVVHIELFLS
GPCSDRLAAVALGRAPVPDPDEGLRVRCTPCRSALRGGRLGLAVSSGRRHQAGAMGEAQK
SRKGLLSPGHHPQKKLPALLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGRE
LGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLSE
FQDKTGKEAADWKKRFIGIRMRTITPSLVEELKASNPDFPAVSSGIYVQEVVPNSPSQRG
GIQDGDIIVKVNGRPLADSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVL
Download sequence
Identical sequences G3MYZ2
ENSBTAP00000054781 ENSBTAP00000054781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]