SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055156 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055156
Domain Number 1 Region: 97-141
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-16
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055156   Gene: ENSBTAG00000046047   Transcript: ENSBTAT00000065493
Sequence length 141
Comment pep:novel chromosome:UMD3.1:X:18837129:18842179:-1 gene:ENSBTAG00000046047 transcript:ENSBTAT00000065493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSKEVTTHQLGNDTALLGGTAVAPGFKWKPAEPQPMGVFQEECSNIYQVLQEPRWNTHKE
SQPVDKGAVPAEESPTFSEEKSTPSWKLTSKLTLPKSQSPLTFEDVALYFSEEEWRIMTP
EQKTLYFDVMGELYEDVTFLG
Download sequence
Identical sequences G3N002
ENSBTAP00000055156 ENSBTAP00000055156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]