SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055716 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055716
Domain Number 1 Region: 7-116
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-25
Family L-arabinose binding protein-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055716   Gene: ENSBTAG00000048061   Transcript: ENSBTAT00000063156
Sequence length 801
Comment pep:known_by_projection chromosome:UMD3.1:29:7128510:7240131:1 gene:ENSBTAG00000048061 transcript:ENSBTAT00000063156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMALCPGYAGLCDAMKPIDGRKLLDSLMK
TNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWAKK
SHIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLT
GCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTAIFIIYRDTPVVKSSSRELCYIILA
GICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTK
KPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTP
LGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYLAALQDHHHVL
SPSASAPRVALGCMFVPKVYIILAKPERNVSAFTTSTVVRMHVGDGKSSAASRSSSLVNL
WKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGNGGRATMSSSNGKSVTWAQNEKSSR
GQHLWQRLSVHINKKENPNQTAVIKPFPKSTEGRGAGGAGGGGPEPPDTGPKARPAAAEA
AERLAVPRAPSPISTLSRHAGGHPDNEDARSLRSEPAARSSSSQGSLLEQISSVVTRFTA
NISELNSMMLASPGAPGAGAALCSAYLIPTEMQLPAAVMTTFAEIQPPPAAEGPGGAAPS
AEGAAREPSPSAAAAGPEAAAGKADLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCI
PSSPKYDTLIIRDYTQSSSSL
Download sequence
Identical sequences G3N1H2
ENSBTAP00000055716 ENSBTAP00000055716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]