SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002600 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002600
Domain Number 1 Region: 955-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-107
Family Thrombospondin C-terminal domain 0.00000000127
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-39
Family Laminin G-like module 0.00000000526
Further Details:      
 
Domain Number 3 Region: 832-953
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.58e-37
Family TSP type-3 repeat 0.000000149
Further Details:      
 
Domain Number 4 Region: 491-543
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.75e-17
Family TSP-1 type 1 repeat 0.0000239
Further Details:      
 
Domain Number 5 Region: 435-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.53e-16
Family TSP-1 type 1 repeat 0.0000366
Further Details:      
 
Domain Number 6 Region: 752-834
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.8e-16
Family TSP type-3 repeat 0.000073
Further Details:      
 
Domain Number 7 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000439
Family VWC domain 0.007
Further Details:      
 
Domain Number 8 Region: 691-775
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000366
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 379-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 10 Region: 547-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000678
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002600   Gene: ENSBTAG00000002006   Transcript: ENSBTAT00000002600
Sequence length 1170
Comment pep:known chromosome:UMD3.1:10:35314025:35329297:1 gene:ENSBTAG00000002006 transcript:ENSBTAT00000002600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGLGVLLLLHACGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDKKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAVERKDHSGQVFSVI
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVFV
TLDNNVVNGSSPAIRTDYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRTGDEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGKARE
TKACQKDSCPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCIGDVTENQI
CNKQDCPIDGCLSNPCFAGVQCTSYPDGSWKCGACPPGYSGDGVECKDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLLCVANATYHCRKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQKDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDQDKVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTSGQVRTLWHDPRHIGWKDFTAYRWHLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
Download sequence
Identical sequences F1N3A1
ENSBTAP00000002600 9913.ENSBTAP00000002600 ENSBTAP00000002600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]