SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002689 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002689
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000151
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 102-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000303
Family Fibronectin type I module 0.092
Further Details:      
 
Domain Number 3 Region: 207-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002689   Gene: ENSBTAG00000002080   Transcript: ENSBTAT00000002689
Sequence length 346
Comment pep:known chromosome:UMD3.1:14:47005560:47013935:-1 gene:ENSBTAG00000002080 transcript:ENSBTAT00000002689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGAQSSSLDLPKQCLCLAFLLLHLLGQVAAAERCPSSCPATCPPKPPTCAPGVRAVLDD
CSCCLVCARQRGESCSVLLPCEESRGLFCDRRADPSAQTGICMAVEGDNCVFDGVIYQSG
ETFQPSCKYQCACQDGQVGCVPRCEEDLLLPQPDCPAPRKVKVPGECCEKWICDSKETGT
LGGLQTLPAYRTEATLGVAVSDSSINCIEQTTEWSACSKSCGMGFSTRVTNRNPHCEMVK
QTRLCMVRPCDQEHRQPTDKKGKKCLRSIKSIKAIHLQFENCTSLNTYKPRFCGICSDGR
CCTPHNTKTIQVEFQCSPGQILKKPVMVIGTCTCHNNCPHSNSSFL
Download sequence
Identical sequences Q2HJ34
9913.ENSBTAP00000002689 NP_001095852.1.59421 NP_001095852.1.76553 ENSBTAP00000002689 ENSBTAP00000002689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]