SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005810 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005810
Domain Number 1 Region: 112-179
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000593
Family VWC domain 0.038
Further Details:      
 
Domain Number 2 Region: 258-325
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000558
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 33-100
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000645
Family VWC domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005810   Gene: ENSBTAG00000004432   Transcript: ENSBTAT00000005810
Sequence length 453
Comment pep:known chromosome:UMD3.1:X:63497121:63590236:-1 gene:ENSBTAG00000004432 transcript:ENSBTAT00000005810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKWMEPVIALDFVIGPCFLTSIFSISFLTDSETYCVFQDKKYRVGERWHPYLEPYGLVYC
VNCICSENGNVLCSRVRCPSLHCLSPVHVPHLCCPRCPEDSLPPANNKMTSKSCEYNGTT
YQHGELFMAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRET
GDGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLPRFPGARSHRGALMDSQ
QASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKK
IHCPNRYPCKYPQKIDGKCCKVCPEELPGQSFDSKGYFCGEETMPVYESVFMEDGETTRK
IALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELHHFKLVTRTTLSQWKIFTEGE
AQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences F1MAZ4
ENSBTAP00000005810 ENSBTAP00000005810 9913.ENSBTAP00000005810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]