SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011877 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011877
Domain Number 1 Region: 34-111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000251
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 2 Region: 813-877
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000001
Family VWC domain 0.0058
Further Details:      
 
Domain Number 3 Region: 401-461
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000126
Family VWC domain 0.0096
Further Details:      
 
Domain Number 4 Region: 679-736
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000146
Family VWC domain 0.013
Further Details:      
 
Domain Number 5 Region: 320-393
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family VWC domain 0.0037
Further Details:      
 
Domain Number 6 Region: 756-811
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000241
Family VWC domain 0.007
Further Details:      
 
Domain Number 7 Region: 600-666
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000429
Family VWC domain 0.0074
Further Details:      
 
Domain Number 8 Region: 566-594
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000523
Family Huristasin-like 0.0084
Further Details:      
 
Domain Number 9 Region: 537-565
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00000321
Family Huristasin-like 0.0039
Further Details:      
 
Domain Number 10 Region: 510-536
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000126
Family Huristasin-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011877   Gene: ENSBTAG00000009020   Transcript: ENSBTAT00000011877
Sequence length 1035
Comment pep:known chromosome:UMD3.1:11:18835047:19041904:1 gene:ENSBTAG00000009020 transcript:ENSBTAT00000011877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLVAGGRGMAGCGHLLVSLQGLLLLLARSGTRALVCLPCDESKCEEPKSCPGSIVQGFC
GCCYMCARQRNESCGGAYGLHGACDRGLRCVIRPPLNGDSITEYEVGVCEDENWDDDQLL
GFEPCNENLVSGCNLINGKCECDTIRTCNNPFEFPRKDMCLSALKRIEEEKPDCSKARCE
VQFSPRCPEDSVLIEGYAPPGECCPLPSRCVCDPAGCLRKVCQPGYLNILLKRASGKPGE
CCDLYECKPVFSVDCSTVECPSFQQTVCPLDSYETQVRLTADGCCTLPTRCECLSGLCGF
PVCEVGSTPRIVSRGDGTPGKCCDVFECVNETKPACVFNNVEYGDGDMFRMDNCRFCRCQ
GGVSICFTAQCGELSCERYYMPEGECCPVCEDPVYPLNNPAGCYANGQIHAHGDRWREDD
CTFCQCINGEPHCVATACGQSCMSPVKVPGECCPVCEEPTYITIDPPACGELSNCTLTEK
DCIYGFKLDHNGCRTCQCKNREELCTGLRRGCTLNCPFGFLTDAYGCETCQCRPRPRKCR
PTVCEKHCPFGYLKNKHGCDICRCKKCPELRCSKICSLGFQKDSHGCLICKCREVSASAG
PPVLSGTCLSMDGHHHKNGESWHDGCRECYCHSGREMCALITCPVPACGNPTIHPGRCCP
SCSDDFVVQKPELSTPSICHAPGGEYFVEGETWHIDTCTQCTCHSGRVLCETEVCPPLLC
QNPTRTQDSCCPQCPDEPLQPSSSHNDSVPSYCKNDEGDIFLAAESWKPDVCTSCVCMDS
VISCYSESCPSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDIDSCTHC
YCLQGQTLCSTVSCPPLPCIEPINMEGSCCPMCPEMYVPEPTNIPIEKTNHREIDMEVPL
WPTPSENDIIHLPRDVGHPQTDHRENTRLNSEESSVDSIASVVVPIIIGLSIVIAFLFIN
QKKQWVPLLCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDGSQRMLRIAEPDARFSGFYSM
QKQNHLQADNFYQTV
Download sequence
Identical sequences F1MW38
ENSBTAP00000011877 ENSBTAP00000011877 NP_001192227.1.59421 NP_001192227.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]