SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016273 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016273
Domain Number 1 Region: 1266-1458
Classification Level Classification E-value
Superfamily vWA-like 2.07e-43
Family Integrin A (or I) domain 0.0000000395
Further Details:      
 
Domain Number 2 Region: 1468-1661
Classification Level Classification E-value
Superfamily vWA-like 4.29e-42
Family Integrin A (or I) domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1683-1872
Classification Level Classification E-value
Superfamily vWA-like 5.13e-38
Family Integrin A (or I) domain 0.00000028
Further Details:      
 
Domain Number 4 Region: 644-706
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000474
Family ATI-like 0.051
Further Details:      
 
Domain Number 5 Region: 293-347
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000011
Family BSTI 0.062
Further Details:      
 
Domain Number 6 Region: 2193-2249
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000229
Family BSTI 0.077
Further Details:      
 
Domain Number 7 Region: 770-826
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000036
Family ATI-like 0.021
Further Details:      
 
Domain Number 8 Region: 2564-2645
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000889
Family VWC domain 0.032
Further Details:      
 
Domain Number 9 Region: 1140-1193
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000932
Family ATI-like 0.053
Further Details:      
 
Domain Number 10 Region: 2420-2494
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000345
Family VWC domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016273   Gene: ENSBTAG00000012265   Transcript: ENSBTAT00000016273
Sequence length 2808
Comment pep:known chromosome:UMD3.1:5:104603432:104727301:1 gene:ENSBTAG00000012265 transcript:ENSBTAT00000016273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPTRLARLLLAVALTLPGALCGEGALGKSSMARCSLFGADFINTFDESMYSFSGDCSYL
LAGDCKTHSFSIVGDFQGGRRMGLSVYLGEFFDIHVFVNGTVLQGGQHVSMPYATRGLYL
ETEVGHHKLSSESYGFVARIDGSGNFQILLSDRHFNKTCGLCGDFNIFAEDDFRTQEGTL
TSDPYDFANSWALSSEEQRCPRVSPPSSSCNVSSELQKGLWEKCQLLKTASVFARCHALV
DPEPFVALCERMLCACAQGLRCPCPVLLEYARACAKQGMLLYGWADHSSCRPDCPAGMEY
KECVSPCHRTCRSLSITEVCREQCVDGCSCPEGQLLDEGRCVESTECPCVHAGKPYPPGA
SLSRDCNTCILAVWVCTKEISPGECLITGQSHFKSFDDRHFTFSGVCQYLLAQDCQDHSF
SVVIETVQCADDPDAVCTRSVTVRLPSPHHGLLKLKHGGGVALDGQDIQIPLLQGDLRIQ
HTVTASLQLNFGEDLQIDWDGRGRLLLKLSPVYAGRTCGLCGNYNGNQRDDFLTPAGLVE
PLVEHFGNSWKLRADCEDLQEQPSDPCSLNPRLTKFADQACAILTSPKFEACHSAVSPLP
YLRNCRYDVCACSDGRDCLCDAVANYAAACARRGVHVGWREPSFCALSCTHGQVYQQCGT
PCNLTCRSLSHPDEECTEVCLEGCFCPPGLFLDETGSCVPKAQCPCYYDGEIFQPEDIFS
DHHTMCYCEDGFMHCSTSGAPGSLLPEAVLSSPLSHRSKRSLSCRPPMVKVVCPADNPRA
EGLECTKTCQNYDLECMSTGCVSGCLCPPGMVRHENRCVALERCPCFHQGREYAPGDRVK
VDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKYLFPGECQYVLVQDHCGSNPG
TFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFDGEVNVKTPMKDETHFEVVESGRYIT
VLLGKALSVVWDGHLAVSVFLKRTYQERVCGLCGNFDGVQNNDLTSSSLQVEENPVDFGN
SWKVSPQCADTQKVRLDSAPAICHDNVMKQTMVDSSCRVLTSDVFRECNRLVNPEPYLDV
CIYDSCSCESIGDCSCFCDTIAAYAHECAQHGQVVTWRTATLCPQNCEERNLKESGYQCE
WRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVNPEDCPVCQVEG
RRLASGKKVTLNPGDPEHCQICHCDGVSLTCEACKEPGGPPPTEGPVIPTTPYVEDIPEP
PLHDFFCSKLLDLVFLLDGSSKLSEADFETLKAFVVGMMERLHISQKRIRVAVVEYHDGS
HAYLALQDRKRPSELRRIAGQVKYAGSEVASTSEVLKYTLFQIFGRIDRPEASRVALLLT
ASQEPPRLARNLVRYVQGLKKKKVSVVPVGIGPHASLKQIRLIEKQAPENKAFVLSGVHE
LEQRMDDIVGYLCDLALEVPAPTLTQHPLAAQVTVAPQLLGPSLPGPKRSSVVLDVAFLL
EGSDEVGEANFNRSAEFVEEVIRRMDVGQDGIHVTVLQYSYVVTVEHSFREPQSKDVVLQ
RLREVRYRGGNQTNTGLALQYLSEHSFSASQGDREQAPNLVYMVTGSPASDKIQRMPGDI
QLVPIGVGPRVDVQELERVSWPQTPIFIQDFERLPREAPDLVLQRCCSEDGPHLPTLAPA
PDCSQPLDVVLLLDGSSTSPASYFDEMKSFAKAFISKANLGPQLTQVSVLQYGSNTNVDV
PWDIHVDKAHLLSLVDPMHREGGPSQVGNALSFAARYITSQVHGARPSASKVVVILVTGS
SMDSVEAAAAAARSNRVAVFPIGIGDQYDAAQLRVLAGPGASSNVAELQRIEDLPSMVAL
GNSFFQRLCSGFVSVCVDEDGNERRPGDVWTLLDQCHTVTCLPDGQTLLKSHRVNCDQGP
QPSCPDGQTPLRMEEACGCRWACPCVCTGSSTRHIVTFDGRNFKLTGNCSYVLFHNKEQD
LEVILHNGFCSAGARQACMKSVEVKQNGLSVELRSNMEVMVNGRLVSVPYLGGDMEVRVY
GTIMFEVRFMGHILSFTPQNNEFQLQLRPKIFASKTYGLCGFCDENGANDFMLRDGTVTE
DWKTLVREWTVQQPGQTCPLGPEEPCPISQGSRCQVLLSELFAECHKVLAPATFHAMCQQ
DSCQQEQVCEAIASYAHLCRTKGVCVDWRTPDFCAVSCPPSLIYNHCESGCPRQCEGNSS
SCGDHPLEGCFCPPHQVMLEGSCVPEEACTQCVGDDGIRHQLLETWVPDHQPCQICTCLS
GRKVNCTTQPCPSAGVPTCGPCEVARLRQSTQQCCPEYECVCDLVSCDVPPVPNCEDGLQ
PVLANPGECRPSFTCVCRKEECPKGSPPSCPPHRMPALRKTRCCDEYECACNCTNSTVSC
PLGYLASTITNDCSCTTTTCLPDKVCVHRGTIYPVGQFWEEGCDTCTCTDLEDAVMGLRV
AQCSQKPCADICRPGFTYVLREGECCGRCLPSACEVVTGSPRGDSQTQWKSVGSHWASPE
NPCLIHECVRVEEEVFVQQRNVSCPQLNVPVCPLGFQLRCQTLGCCPTCRCEPVQACVLN
GTIIGPGKTVMVDACMTCRCHVQAGVISGFKLECRKTTCQACPAGYMEEKLQGECCGRCL
PTACTIQLRGGQIMMLKRDETLQDGCDSHFCKVNKRGEFIWEKRVMSCPPFNEHKCLAEG
GEIMKIPGTCCDTCEEPECKDITARVKSIKVGDCKSEDEVDIHYCQGRCTSKALYSIDTE
DVQDQCSCCSPTRTEPMPVPLRCTNGSIIHHVVLNALQCQCSSRKCSP
Download sequence
Identical sequences F1N0R5
ENSBTAP00000016273 ENSBTAP00000016273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]