SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047951 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047951
Domain Number 1 Region: 7-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047951   Gene: ENSBTAG00000032264   Transcript: ENSBTAT00000052348
Sequence length 45
Comment pep:known chromosome:UMD3.1:2:55560967:55561101:1 gene:ENSBTAG00000032264 transcript:ENSBTAT00000052348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEEVETKCPWNHIACLGANKCIHLSQLCNGVLDCLDGYDEGVHCR
Download sequence
Identical sequences H7BWW3
ENSBTAP00000047951 ENSBTAP00000047951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]