SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053502 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053502
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 70-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053502   Gene: ENSBTAG00000044158   Transcript: ENSBTAT00000061639
Sequence length 345
Comment pep:known chromosome:UMD3.1:15:67240027:67518041:1 gene:ENSBTAG00000044158 transcript:ENSBTAT00000061639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLGPLCLLLSSAADSQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD
EKECPKAKSKCGPTFFPCASGVHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHC
KNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSS
VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHRCNVTYNVNNGIQ
YVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA
DSASSQAASSLLSVDDTSHSPGQPGPQEGTAEPRDSAPSQGTEDV
Download sequence
Identical sequences E1BNK5
ENSBTAP00000053502 NP_001179548.1.59421 NP_001179548.1.76553 ENSBTAP00000053502 9913.ENSBTAP00000053502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]