SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053671 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053671
Domain Number 1 Region: 217-276
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000471
Family VWC domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053671   Gene: ENSBTAG00000044068   Transcript: ENSBTAT00000061274
Sequence length 326
Comment pep:known chromosome:UMD3.1:4:5908623:6036680:-1 gene:ENSBTAG00000044068 transcript:ENSBTAT00000061274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSTAMAVGALSSSLLLTCCLMVALCSPRIPLEKLAQAPERPGQEKREHASRDGPGRVS
ELGRPARDEGGGGGRDWKGKSGRGLAGREAWSRQKQAWAAQGGGAGAGDLQGRPRGDTPH
EELPAVAAQDVAGPESEPTPEPPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCL
CTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERC
RCEASGEVLCAVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTI
CHCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences E1BE14
ENSBTAP00000053671 XP_003585984.1.76553 XP_010802270.1.76553 XP_015318402.1.59421 XP_015318403.1.59421 ENSBTAP00000053671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]