SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002337 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002337
Domain Number 1 Region: 174-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 32-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000194
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002337   Gene: ENSBTAG00000001784   Transcript: ENSBTAT00000002337
Sequence length 273
Comment pep:known chromosome:UMD3.1:2:131589017:131597324:-1 gene:ENSBTAG00000001784 transcript:ENSBTAT00000002337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCQLLQLPQRLLLLGAATLTASALHTADLVDLCGRTRQADGLLLRSHSASRRFYFVAPDM
DCGLWVRAAAPGDRIRLQFRFFLVYSLAPPSMPPPALNASAPLQADPCAPGSYLQLYEGP
PGTPRPLGAPLCGLTIPAPVTTSGDLLGLRLVTRGRQPRVDFVGEVTSFRLGSCGAYFPC
RNGRCIPPSLVCDRWAMDNCGDGSDQASWPPANCGAASPESSQEGNTDDSTSQTLTPSAA
LPSSGPLGTAAEMSPPAHWDPARQGVALEGRWL
Download sequence
Identical sequences F1N2I2
ENSBTAP00000002337 ENSBTAP00000002337 9913.ENSBTAP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]