SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003869 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003869
Domain Number 1 Region: 27-269
Classification Level Classification E-value
Superfamily CutC-like 2.35e-81
Family CutC-like 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003869   Gene: ENSBTAG00000002971   Transcript: ENSBTAT00000003869
Sequence length 273
Comment pep:known chromosome:UMD3.1:26:20550908:20583501:1 gene:ENSBTAG00000002971 transcript:ENSBTAT00000003869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGT
TPSMGVLQVVKQYVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALT
EDGHIDKELCMSLVALCRPLPVTFHRAFDMVHDPVAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIDQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSARDSGMKFRNSSV
AMGASLSNSEYSLKVTDVTQVRTLNAIAKNILV
Download sequence
Identical sequences H7BWV5 W5PTA5
ENSBTAP00000003869 ENSOARP00000013686 ENSBTAP00000003869 NP_001193825.1.59421 NP_001193825.1.76553 XP_004020152.1.66739 XP_005980738.1.78601 XP_006064635.1.26621 XP_010857844.1.44457 XP_011975137.1.54773 XP_017896778.1.57651 XP_020752982.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]