SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004210 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004210
Domain Number 1 Region: 271-463
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.46e-64
Family Hemopexin-like domain 0.00000136
Further Details:      
 
Domain Number 2 Region: 100-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.31e-54
Family Matrix metalloproteases, catalytic domain 0.00000482
Further Details:      
 
Domain Number 3 Region: 18-95
Classification Level Classification E-value
Superfamily PGBD-like 3.61e-19
Family MMP N-terminal domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004210   Gene: ENSBTAG00000040567   Transcript: ENSBTAT00000004210
Sequence length 510
Comment pep:known chromosome:UMD3.1:15:6195378:6209163:1 gene:ENSBTAG00000040567 transcript:ENSBTAT00000004210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNLLLLLVFVTLSSAFPADQRMEDEENLQLTQAYLNQFYSLEIEGSHLAQSSNRSLIDG
KIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWKKYNLTYRIVNYTPD
MARADVDEAIQKGLEVWSKVTPLIFTKISKGIADIMIAFKTRVHGSCPRYFDGPLGVLGH
AFPPGLGLGGDTHFDEDENWTKDGVGFSLFLVAAHEFGHSLGLSHSSDQTALMFPNYVSL
DPSKYPLSQDDINGIQSIYGPPKVPEKPKGPTLPHACDPDLTFDAITTFRREVMFFKGRH
IWRIYYDITDVEFELISSFWPSLPADIHAAYENPIDKILVFKDDNFWVIRGYAVLPDYPK
SIYTLGFPRRVKKIDAAVCDRSTRKTYFFVGIWCWRYDEVTQTMDKGYPRRVVKYFPGIG
LRVDAAFQHKGFFYFFRRSKQFEYDPKAKTVTRIMKTNTWLQCKEPLNSSSDFTISEGKV
HSGVEMFHYKSLNFLIFSIVHMMNKIYSYQ
Download sequence
Identical sequences F1MY91
ENSBTAP00000004210 ENSBTAP00000004210 XP_005899572.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]