SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004917 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004917
Domain Number 1 Region: 832-1120
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-78
Family Protein kinases, catalytic subunit 0.000000000326
Further Details:      
 
Domain Number 2 Region: 559-738
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-27
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 446-578
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000182
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 353-453
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000424
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 135-215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000679
Family I set domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000004917
Domain Number - Region: 316-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00051
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 216-347
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0143
Family Growth factor receptor domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004917   Gene: ENSBTAG00000003777   Transcript: ENSBTAT00000004917
Sequence length 1139
Comment pep:known chromosome:UMD3.1:3:103278178:103297710:-1 gene:ENSBTAG00000003777 transcript:ENSBTAT00000004917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWLEPPLLLPIFFLASHVGAAVDLTLLADLRLTEPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPRPWQPPHIARNGSSRVTVRGFSQPSDLVGVFSCVGGAGTRRTRVLYV
HNSPGAHLLPDKVTHTVNKGDTAVLSARVRKEKQTDVIWKSNGSYFYTLDRHEAQDGQFL
LQLPNVQPSSSGIYSATYLEASPLGSAFFRLIVRGCEAGRWGQDCTKECPGCLHGGVCHD
QDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTSGCRGLTFCLPDPYGCSCGSGWRG
SQCQEACAPGRFGADCHLQCQCQNGGTCDRFSGCVCPSGWHGMHCEKSDRIPQILDMVSE
LEFNLDTMPRINCAAAGNPFPVRGSMELRKPDGTVLLSTKAIVEPDRTTAEFEVPRLALG
DSGLWECRVSTSGGQDSRRFRINVKVPPVPLTAPRLLAKQSRQLVVSPLVSFSGDGPIAS
VRLHYRPQDSTMAWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMT
TDCPEPLLKPWLEGWHVEGPDRLRVSWSLPPVPGPLVGDGFLLRLWDGARGQERRENVSS
PQARTALLTGLTPGTYYQLDVRLYHCTLLGPASPAARVLLPPSGPPAPRHLHAQALSDSE
IQLMWQRPEAAAGPISKYIVEVQVAGGSGDPLWMDVDRPEETSTIVRGLNASTRYLFRVR
ASVQGPGDWSNVVEQSTLGNGLQIEGPVQEIHAAEEGLDQQLVLAVVGSVSATCLTILAA
LLTLACIRKSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLNYPVLEWEDI
TFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPN
IINLLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRF
ASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRW
MAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCD
DEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Download sequence
Identical sequences F1MX81
9913.ENSBTAP00000004917 ENSBTAP00000004917 ENSBTAP00000004917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]