SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004986 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004986
Domain Number 1 Region: 135-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-85
Family Eukaryotic proteases 0.0000000108
Further Details:      
 
Domain Number 2 Region: 52-157
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000157
Family Hepsin, N-terminal domain 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004986   Gene: ENSBTAG00000003829   Transcript: ENSBTAT00000004986
Sequence length 417
Comment pep:known chromosome:UMD3.1:18:45971859:45991833:1 gene:ENSBTAG00000003829 transcript:ENSBTAT00000004986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKEGGRTVPCCSGPKVAALTVGTVLLLTGIGAASWAIVTVLLRSDQEPLYPVQVGPAD
ARLTVFDQTEGTWRLLCSSRSNARVAGLSCEEMGFLRALDFSELDVRTAGANGTSGFFCV
DEGRLPHARRLLEVLSVCDCPRGRFLATSCQDCGHRKLPVDRIVGGQDTSLGRWPWQVSL
RYDGAHLCGGSVLSRDWVLTAAHCFPERNRVLSRWRVFAGAVAQTSPHGVQLGVQAVIYH
GGYLPFRDPNSEENSNDIALVHLSGTLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences A1L5C6
9913.ENSBTAP00000004986 ENSBTAP00000004986 NP_001073710.1.59421 NP_001073710.1.76553 XP_005896151.1.15283 XP_006065344.1.26621 XP_019834676.1.53367 ENSBTAP00000004986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]