SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010226 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010226
Domain Number 1 Region: 138-324
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.14e-50
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000294
Further Details:      
 
Domain Number 2 Region: 14-136
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.05e-36
Family DNA repair glycosylase, N-terminal domain 0.000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010226   Gene: ENSBTAG00000007777   Transcript: ENSBTAT00000010226
Sequence length 347
Comment pep:known chromosome:UMD3.1:22:17001861:17007470:-1 gene:ENSBTAG00000007777 transcript:ENSBTAT00000010226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMSVVSLLRGSMGHRTLASFPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGV
LADQVWTLTQTEEHLYCTVYRGDKGRVGRPTLEELKAVQQYFQLDVSLAPLYHHWSSVDP
HFQEVAQKFKGVRLLQLDPIECLFSFICSSNNNIARITGMVERLCQTFGPRLIQLDDVTY
HGFPSLQALAGPEVEAQLRNLGLGYRARFVSASARAILEERGGLPWLQQLRKAPYEEAHK
ALCTLPGVGTKVADCICLMALDKPQAVPVDVHVWQIAQRDYSWHPTTSQAKGPSPQANKE
LGNFFRNLWGPYAGWAQAVLFSADLRQLQQAQEPPAKRRKRCTGPEG
Download sequence
Identical sequences F1MPV2
NP_001073754.2.59421 NP_001073754.2.76553 XP_005907132.1.15283 XP_019840275.1.53367 ENSBTAP00000010226 ENSBTAP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]