SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013222 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013222
Domain Number 1 Region: 313-509
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.85e-69
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 117-283
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.07e-56
Family Matrix metalloproteases, catalytic domain 0.000000107
Further Details:      
 
Domain Number 3 Region: 37-100
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-19
Family MMP N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013222   Gene: ENSBTAG00000010024   Transcript: ENSBTAT00000013222
Sequence length 585
Comment pep:known chromosome:UMD3.1:13:65172554:65202229:1 gene:ENSBTAG00000010024 transcript:ENSBTAT00000013222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPHPHPSISSNIPRTTLSITGDLGNTEEGESTGLGSENWLKSYGYLLPYDSRSSALHSG
KALQSAVATMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRHKRYALTGQKWR
QKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFF
ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHEL
GHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGVWRIHSPSERKHERQPR
PPRPPLGDRPATPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL
RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYK
GRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEAERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV
Download sequence
Identical sequences F1MTK6
ENSBTAP00000013222 ENSBTAP00000013222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]