SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015103 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015103
Domain Number 1 Region: 102-196
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-29
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 23-79
Classification Level Classification E-value
Superfamily L27 domain 5.89e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015103   Gene: ENSBTAG00000011367   Transcript: ENSBTAT00000015103
Sequence length 233
Comment pep:known chromosome:UMD3.1:5:10409389:10566010:-1 gene:ENSBTAG00000011367 transcript:ENSBTAT00000015103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSE
FCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGF
NVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKD
SVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
Download sequence
Identical sequences A0A096N3P6 A0A0D9QV61 A0A1S3FGX9 A0A2I2YLC3 A0A2K5EAW0 A0A2K5LEQ9 A0A2K5RRB6 A0A2K5X044 A0A2K5XMG2 A0A2K6DH40 A0A2K6EQL3 A0A2K6JYF5 A0A2K6Q0F8 A0A2K6U5U3 D2H508 G1SLA4 H2NI61 H2Q6J4 M3WLS3 O14910 Q32LM6 U3CNL2 W5Q0N9
ENSGGOP00000002110 ENSOCUP00000003636 ENSAMEP00000013887 ENSMMUP00000015316 ENSPPYP00000005475 ENSP00000447488 ENSOARP00000016275 ENSBTAP00000015103 ENSMMUP00000015316 ENSPPYP00000005475 ENSPANP00000006976 ENSP00000261203 ENSP00000447488 ENSFCAP00000013925 9544.ENSMMUP00000015316 9600.ENSPPYP00000005475 9606.ENSP00000261203 9913.ENSBTAP00000015103 9986.ENSOCUP00000003636 ENSOCUP00000003636 ENSBTAP00000015103 ENSAMEP00000013887 NP_001073070.1.59421 NP_001073070.1.76553 NP_004655.1.87134 NP_004655.1.92137 XP_001087299.1.72884 XP_002711412.1.1745 XP_002823593.1.23681 XP_002916821.1.58354 XP_003783432.1.62490 XP_003811707.1.60992 XP_003927884.1.74449 XP_003989126.1.62641 XP_004006269.1.66739 XP_004053672.1.27298 XP_004417963.1.5094 XP_004675911.1.23501 XP_005571692.1.63531 XP_005953913.1.78601 XP_006075212.1.26621 XP_006871895.1.41390 XP_006882603.1.29581 XP_008002315.1.81039 XP_008573657.1.73410 XP_009002537.1.60252 XP_010381974.1.97406 XP_010957114.1.22495 XP_010957115.1.22495 XP_010957117.1.22495 XP_010957118.1.22495 XP_010973398.1.51371 XP_010973399.1.51371 XP_010973400.1.51371 XP_010973401.1.51371 XP_011725335.1.29376 XP_011849776.1.47321 XP_011905236.1.92194 XP_011996844.1.54773 XP_012297517.1.9421 XP_012513616.1.63892 XP_012875560.1.60039 XP_015103480.1.17985 XP_015103486.1.17985 XP_015103489.1.17985 XP_016779408.1.37143 XP_017398966.1.71028 XP_017725937.1.44346 XP_017903091.1.57651 XP_019310757.1.44245 XP_019652579.1.58354 XP_019815865.1.53367 XP_020028654.1.5219 ENSGGOP00000002110 gi|4759306|ref|NP_004655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]