SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015136 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015136
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.89e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000015136
Domain Number - Region: 208-322
Classification Level Classification E-value
Superfamily ALDH-like 0.0281
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015136   Gene: ENSBTAG00000011388   Transcript: ENSBTAT00000015136
Sequence length 356
Comment pep:known chromosome:UMD3.1:8:59768559:59771818:-1 gene:ENSBTAG00000011388 transcript:ENSBTAT00000015136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLKGSVQASARAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPIPEAQDSVSSRSSRDVRSTDASLDEELDRVKLS
Download sequence
Identical sequences A5PJA6 L8I8N3
XP_005900820.1.15283 XP_019821687.1.53367 9913.ENSBTAP00000015136 ENSBTAP00000015136 ENSBTAP00000015136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]