SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020880 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020880
Domain Number 1 Region: 114-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-47
Family Hypothetical protein AT3g04780/F7O18 27 0.0000565
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.17e-22
Family Thioltransferase 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020880   Gene: ENSBTAG00000015731   Transcript: ENSBTAT00000020880
Sequence length 289
Comment pep:known chromosome:UMD3.1:24:56404067:56446678:-1 gene:ENSBTAG00000015731 transcript:ENSBTAT00000020880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDMTFLESDCDEQLLITVAFNQPVKLYSM
KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH
Download sequence
Identical sequences A0A250YEL6 F1MLV3 F1S1X9 G1M850 I3LVX5 M3WR62
ENSAMEP00000015520 ENSAMEP00000015520 NP_001231205.1.46622 XP_002920303.1.58354 XP_004266171.1.21590 XP_004316215.1.83887 XP_004683985.1.23501 XP_005323098.1.77405 XP_005373027.1.28644 XP_005896944.1.15283 XP_006055346.1.26621 XP_006182830.1.101512 XP_006205813.1.17985 XP_007080538.1.5354 XP_007116418.1.24612 XP_007192019.1.59432 XP_007455347.1.90284 XP_010959629.1.22495 XP_010995507.1.51371 XP_011286460.1.62641 XP_011976216.1.54773 XP_012908189.1.14098 XP_014934649.1.86478 XP_014959265.1.66739 XP_017895096.1.57651 XP_019319499.1.44245 XP_019842213.1.53367 XP_020042490.1.5219 XP_021542051.1.83697 ENSBTAP00000020880 ENSSSCP00000004891 ENSSSCP00000004891 9823.ENSSSCP00000004891 9913.ENSBTAP00000020880 ENSBTAP00000020880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]