SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040675 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040675
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 7.46e-23
Family L27 domain 0.0000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040675   Gene: ENSBTAG00000023415   Transcript: ENSBTAT00000043080
Sequence length 201
Comment pep:known chromosome:UMD3.1:18:56081111:56084735:1 gene:ENSBTAG00000023415 transcript:ENSBTAT00000043080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVEPLGLEREVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDT
LDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEE
MEARFEKMRSARRRQQHQSYS
Download sequence
Identical sequences Q2KIB6
ENSBTAP00000040675 ENSBTAP00000040675 NP_001040042.1.59421 NP_001040042.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]