SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041504 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041504
Domain Number 1 Region: 2060-2221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.89e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0068
Further Details:      
 
Domain Number 2 Region: 2530-2587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000119
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 2955-3013
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000353
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 4241-4289
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000602
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 3988-4045
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000876
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 6 Region: 2688-2738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 7 Region: 3228-3276
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000051
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 8 Region: 3798-3847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000106
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 9 Region: 2801-2856
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000392
Family TSP-1 type 1 repeat 0.00071
Further Details:      
 
Domain Number 10 Region: 3931-3988
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000824
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 11 Region: 3379-3438
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000902
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 12 Region: 1266-1329
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000013
Family ATI-like 0.062
Further Details:      
 
Domain Number 13 Region: 3062-3119
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000144
Family BSTI 0.044
Further Details:      
 
Domain Number 14 Region: 3622-3665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00083
Further Details:      
 
Domain Number 15 Region: 1558-1595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 16 Region: 2477-2530
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 17 Region: 1412-1450
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 18 Region: 1690-1738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000458
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 19 Region: 2441-2476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 20 Region: 3159-3196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 21 Region: 3446-3494
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 22 Region: 4810-4867
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000419
Family BSTI 0.067
Further Details:      
 
Domain Number 23 Region: 1372-1408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 4602-4655
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000602
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 25 Region: 2378-2417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 26 Region: 1488-1526
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 27 Region: 817-877
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000772
Family ATI-like 0.048
Further Details:      
 
Domain Number 28 Region: 4970-5037
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000847
Family VWC domain 0.046
Further Details:      
 
Domain Number 29 Region: 4756-4805
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000889
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 30 Region: 1448-1484
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000942
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 3017-3057
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000968
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 32 Region: 2224-2261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 33 Region: 1806-1866
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000157
Family BSTI 0.041
Further Details:      
 
Domain Number 34 Region: 1598-1638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 35 Region: 4045-4104
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000703
Family BSTI 0.039
Further Details:      
 
Domain Number 36 Region: 1746-1798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000719
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Domain Number 37 Region: 4916-4980
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000863
Family ATI-like 0.019
Further Details:      
 
Domain Number 38 Region: 4412-4470
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000101
Family ATI-like 0.015
Further Details:      
 
Domain Number 39 Region: 2747-2796
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 40 Region: 1902-1960
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 41 Region: 4670-4718
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000051
Family ATI-like 0.055
Further Details:      
 
Domain Number 42 Region: 3866-3918
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000549
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 43 Region: 3291-3340
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000638
Family BSTI 0.034
Further Details:      
 
Domain Number 44 Region: 4302-4352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000863
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 45 Region: 918-972
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000103
Family ATI-like 0.078
Further Details:      
 
Domain Number 46 Region: 4146-4193
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000123
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 47 Region: 964-1010
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000136
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number 48 Region: 884-914
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000322
Family PMP inhibitors 0.0021
Further Details:      
 
Domain Number 49 Region: 3767-3815
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000345
Family VWC domain 0.044
Further Details:      
 
Domain Number 50 Region: 2856-2921
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000441
Family BSTI 0.037
Further Details:      
 
Domain Number 51 Region: 3672-3729
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000981
Family BSTI 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041504   Gene: ENSBTAG00000008542   Transcript: ENSBTAT00000043975
Sequence length 5141
Comment pep:known chromosome:UMD3.1:4:113437377:113490743:1 gene:ENSBTAG00000008542 transcript:ENSBTAT00000043975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPALLFGAAWALANGRWCEQTETVLVEEEVTPRQEDLVPCASLQHYQRRGWRLDLTWS
GRAGLCAIYKPPETRPAAWNRTVRACCPGWGGTHCTLVHPEASPEGHCFATWLCNLGAGS
VNASAGSLEECCAQPWGHSWRDGRSQTCHSCSNHSRLGSTPSPAILQPLAGAVAQLWSQR
QRPSATCATWSGFHYRTFDGRHFHFLGRCTYLLAGAADATWAVHLQPMGHCPQPGHCQLA
RVMMGPEEVLIRGENVTVNGRLVPEGASQLLPGLSLQWQGDWLVLSGGLGVVVRLDRSSS
VSISVDQELQGQTQGLCGVYNGQPEDDFLEPGRGLAALAATFGNSWRLPDSELGCLDAVE
AAQGCEDPLRGTETGTEAGQLRAEAQDVCHQLLEGPFRECHTQVPPAEYHEACLFAYCAG
APAGSGRAERLEAVCATLASYAQDCAARRIAVRWRKPGFCDEICRVMQRYSTCFSVTLPN
LPTLSLSHRVSLSEISLLACENANRSLWNGPLSXPSAPAPSIQYRASNLDWQLVSYVCQM
WPFLCSDRVPLCPLSDCPVTFSFGGIFVCFCFRRXSFRGRAGCRFILVQDFAKRQLLIVL
EHGDCDAGSCLHAISVSLGDTLVQLRDSGVVLVDGQDVALPWSAAGGLSVSRASSSFLLL
RWPGARILWGVSDPAAYITLDPHHAHQVQGLCGTFTRNQQDDFLTPAGDVETSITAFASK
FQVAGGGTCSLEASTPLSPCSTHTERQVFAEVACAILHGPTFQECHGLVDREPFHLRCLA
AVCGCTPGRDCLCPVLAAYARRCAQEGALPSWRNQTFCPVLCPGGQEYQECAPACGRNCG
EPEDCGELDNCVAGCNCPLGLLWDPEGQCVPPNLCPCQLGAHRYAPGSATMKDCNHCVCQ
ERGLWNCTAHHCAPPRTFCPRELVYVPGACLLTCDSLDADRTCPPGSPGGCVCPPGTVLL
EERCVPPELCPCRHGGQWYLPNATIQEDCNLCVCQGQQWHCTGQRCDGRCRASGAPHYVT
FDGLALTFPGACEYLLVREASGQFMVSAQNLPCGASGLTCTKALTVRLQGTVVHMLRGRA
VMVNGVSVTPPKVYSGPGLSLHTAGLFLLLSTHLGLTLLWDGGTRVLVQLSPQLRGRVAG
LCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLGPLCPEPGDLPHPCAVNAHRAGWARAR
CGVVLQPLFARCHVEVPPQQHYEQCVYDACGCDSGGDCECLCSAIATYADECARHGIHVR
WRSQELCPLQCERGQVYEACGPTCPATCHDHRPEPGWPCRAVACVEGCFCPEGTLLHGGV
CLEPAACPCEWGGSFFPPGTVLQKDCGNNCTCRESQWLCGDDGGRCVEPGPGCAEGETPC
RESGHCVPHGWLCDNQDDCGDGSDEEGCATPVCGEGQVSCSSGRCLPLVLLCDGQDDCGD
GMDEQGCPCPQDSLTCADGHCLPPARLCDGHPDCPDGADEESCLGQVDCAPGEVSCVDGT
CLGAIQLCDGVWDCLDGADEGPGHCPLPSLPTPPAGTLPGPSAVSWLHLPPWPVSALALP
CGPLDFACGSGECAPRGWRCDGEEDCADGSDESGCDRPCAPHHAPCARGSHCVAAEQLCD
GVPHCPDGSDEDPGACERLQAPGGPNRTGLPCPEYSCPDGLCIGFQQVCDGQPDCELAGT
AGPSPEEQGCGAWGPWSPWELCSRTCGPGVQGRSRRCSPPSLPVLWHCPGPERQTRACFA
AACPEDGAWTSWSRWSPCSEPCGGVTARHRECHPPQNGGRTCATLPGGPPSTRETRPCPQ
DGCPNVTCSGELVFHACVPCPLTCDDISGQATCPPDRPCGGPGCWCPAGQVLGAQGRCVW
PRQCPCLVDGSRYWPGQRVKTDCQLCVCQDGRPRRCQPSPDCAVNCGWSAWSPWAECLGP
CGSRSVQWSFRSPNNPRPAGRGHQCRGLHRKARRCQTEPCEGCEQDGRVHRVGERWRAGP
CRVCQCLHDGSARCSPYCPLGSCPQDWVLVEGVGESCCHCVPPGENQTVHPMATPVPAPT
PSPQIGAPLITYLLPPPGDPCYSPLGLARLPEGSLPASSQQLEHPAWAAILRPAPGAPGW
SPVEHADTQGHTPPPYLQLDLLQPRNLTGIIVQGAGSSDWLQVSSDGLHWHSYRDIQPGT
QPAPQLFPKNWNGPSTVWMFARMVQARHVRVWPSDGHHQAAPSSDANLDGPLRVELLGCE
PAPLCLGVGHRCVSGECAPRGAPCDGVEDCKDGSDEEGCVTPPAGAGRIESTAWSSAPSS
AQPGQLPPQPSEGLAEAEADHWHPGRGSPVPPTGKGPASLGSEPHPSPGGSVQTVTPTSQ
PEAQALRPEMAAVTVLPPHPMVTPEVPAGRSTTPGPFPHVQCSPGQVPCEVLGCVELEQL
CDGREDCLDGSDERPCAWAAGTVPFTVPTTTLPGLPASRDLCSPSQLTCGSGECLPAERR
CDLQLDCQDGSDENGCVDCGLAPWSGWSSCSRSCGLGLAFQRRELLRPPLPGGSCPPDRL
RSQPCFVQACPVAGAWAEWEAWGPCSVSCGGGHRSRRRSCMDPPPKNGGAPCPGPPQERA
PCGLQPCAGGTGAGAGGHLRGEPRVKGTVPGCPCWAFNPRPSAELNMLTLAWPSLPPFLP
HPPSPAHRPPSAMSGVVFHPHTIQQLFRHPPSVCEKGALLCEPGGCPVPCGWSAWSSWGP
CDRSCGSGLRARFRSPSNPPAASGGAPCEGQRQELQACYSACGAEVPGWTPWAPWSACSQ
SCLVPGGGPALRSRSRLCPGPGDTSCIGEATEEEPCSPPVCLGLGVWGQWAAWSACSAPC
NGGVQTRGRRCSASAPGDPGCQGPHSQTRDCNTQPCTAQCPGDMVFRSAEQCRWEGGPCP
GLCLARGPGVECTGVCTAGCACPAGLFLHNSSCLPPSQCPCQLRGQLYAPGAVARLDSCS
NCTCISGEMVCASEPCPVACGWSPWTPWSLCSRSCNVGVRRRFRAGTAPPAAFGGAACQG
PNMEAEFCSLRPCGGPGGEWGPWSPCSVPCGGGYRNRTRGSSGPSPVDFSTCGLQPCAGP
APGVCPPGKRWLDCAQGPASCAELSAPRGADQPCHPGCYCPSGMLLLNNVCVPTQDCPCT
HGGRLHPPGSAVLRPCENCSCVSGLITNCTSWPCKEGQPTWSPWTPWSECSASCGPARRH
KHRFCTRPPGGAPSSMAPPLLLSSVPPLCPGPEAEEEPCLLPECDRAGGWGPWGPWSSCS
RSCGGGLRSRSRACDQPPPQGLGDYCEGPRAQGAACQALPCPVTNCTAIEGAEYSACGPP
CPRSCDDLVHCVWHCQPGCYCPPGQVLSADGTVCVQPGHCSCLDLLTGERHRPGAQLAKP
DGCNYCTCSEGQLTCTDLPCPVPGAWCPWSEWTACSQPCQGQTRTRSRACSCPAPQHGGA
PCPGEAGEAGAQHQRETCASTPECPVDGAWSPWGPWSPCDVCLGQSHRSRECSWPPTSEG
GRPCPGGHRQSRPCQGNSTQCTDCAGGQDLLPCGQPCPRSCEDLSPGVECQPDSMGCQQP
RCGCPPGQLSQDGLCVTPSQCRCQYQPGAMGIPENQSRSAGSGLSSWESLEPGEVVTGPC
DNCTCVAGILQCQEVPACSRLGLWGSWGPWEDCSVSCGGGEQLRSRRCPRPPCPGPARQS
RTCRTQVCREAGCPAGRLYRECQPSEGCPFSCAHVTGQVGCFSAGCEEGCHCPEGTFLHR
SACVQECPCVLTALWLQGLGAAGADPGAHLSVLGENGQPLGPGDELGSGQSLRTGCHNCS
CAHGKLSCSVEACSKAAGGFSPWGPWGPCSRSCGGLGTRTRSRQCVRPMPAPGGQGCHGP
HWDLEYCPSPECPGAAGSTAEPATGLPGGWGLWSPWSPCSGTCTDPAHPAWRSRSRLCLA
NCTGGAASQERPCNLPSCTELPLCPGPGCEAGNCSWTAWAPWEPCSRSCGVGQQRRLRAY
HPPGPGGHWCPDVLTAYQERRFCNLRACPVPGGWSRWSPWSWCDRSCGGGRSLRSRSCSS
PPPKNGGAPCVGERHHARLCNPTPCEEGCPAGMEVVSCANRCPRRCSDLQEGIVCQEDQA
CQQGCRCPEGSLEQDGGCVPLGHCECTDAQGHSWAPGSQHQEACNNCTCRAGQLSCTAQP
CPPPAHCAWSRWSAWSPCSRSCGPAGQQSRFRSSTSGSWAPECREEQSQSQPCPQSPCPP
LCLQGTRPRSLGDSWLQDGCQQCSCTPEGIICEDAECAGLGAWTPWSPWSDCPVSCGGGN
QVRTRVCVASAPPRGGSPCLGPDVQSQRCGLWPCPALPDTCSWGPWGPCSRSCGPGLASR
SASCPCLLAEAEPACNSTSPRLDTQACYAGPCLEECVWSSWSSWTRCSCEVLVQQRYRHQ
RPAPGGAGAGPPCTRLDGHFRPCLTGNCSEDSCAPPFEFQACGSPCTGLCATYLSPWLCQ
DLPPCQPGCYCPEGLLEQAGGCVPPEQCNCQHVSGEGAGVTLAPGDRLQLGCKECECQRG
ELQCTSQGCQGLLPLSGWSEWSPCGPCLPLGLLAPASRAALEERWPQDTAGLSPTSAPTL
ASEQHRHRLCLDPETGRPWAGDPDLCTVPLSQQRLCPDPGACQDLCQWGPWGAWSPCQVP
CSGGFRLRWREAGIPPGGGCRGPWAQTESCNMGPCPGESCEAQDTVPTPDCANQCPRSCV
DLWDRVECLQGPCRPGCRCPPGQLVQDGHCVPVSSCRCGLPSPNASWALAPAEVVRLDCR
NCTCVNGSLACSSHECPTLGPWSAWSNCSAPCGGGTTKRHRSCKEGPGVTPCQAQDMEQQ
QDCNLQPCPECPPGQVLSACAVSCPRLCSHLQPGTPCMQEPCQLGCDCPRGQLLHNGTCV
PPAECPCTQLSLPWGLTLTLEEQHRELPPGTLLTQNCTHCTSQGGAFSCSLTDLSECPPG
ETWQHVAPGELGPCEQTCREPNATETQGNCSGRQAPGCVCQRGHFRSQEGPCVPVDLCEC
WHHGRPHLPGSEWQEACESCRCVSGESICTQHCPPLTCAQGETAVQEPGGCCPTCRQEAP
EEQPVSCRHLTELRNLTKGACYLEQVEVNYCSGHCPSSTNVLPEEPYLQSQCDCCSYRLD
PENPVRILNLRCPGGRTELVVLPVIHSCQCSACQGGDFSER
Download sequence
Identical sequences F1MLA7
ENSBTAP00000041504 ENSBTAP00000041504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]