SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052577 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052577
Domain Number 1 Region: 398-612
Classification Level Classification E-value
Superfamily L domain-like 1.93e-36
Family Ngr ectodomain-like 0.0067
Further Details:      
 
Domain Number 2 Region: 48-281
Classification Level Classification E-value
Superfamily L domain-like 3.88e-33
Family Ngr ectodomain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052577   Gene: ENSBTAG00000017180   Transcript: ENSBTAT00000022827
Sequence length 980
Comment pep:known chromosome:UMD3.1:1:103001088:103004030:1 gene:ENSBTAG00000017180 transcript:ENSBTAT00000022827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHI
HCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQTG
AFNGLKILKRLYLHENKLDIFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLI
LNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRSLMELQLEENPWNCTCE
IVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHLS
SNKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYPGPNQPP
IAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNL
IQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGL
QSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYF
LYLPVAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTH
RDVRTIELEVLCPEMLHIAPAGASPAQPGDAHLAGGPTSASPYEFSPPGGPVPLSVLILS
LLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGN
GGGGRPTISSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVVVSSGPEAGGAERGA
PVTQPPGMGEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTMNHHHPH
PHHSAVGGVSGVVAGTGGDLVGFRHHEKNGGVVLFPPGGGCGGSSMLLDRERPQPAPCTV
GFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELR
AKLQTKPDYLEVLEKTTYRF
Download sequence
Identical sequences F1N513
XP_003585735.1.76553 XP_003585736.1.76553 XP_005895397.1.15283 XP_005895398.1.15283 XP_010822681.2.59421 XP_010839227.1.44457 XP_015317574.1.59421 ENSBTAP00000052577 ENSBTAP00000052577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]