SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053488 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053488
Domain Number 1 Region: 375-533,613-744
Classification Level Classification E-value
Superfamily L domain-like 6.32e-56
Family Ngr ectodomain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 1012-1201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-44
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 143-349
Classification Level Classification E-value
Superfamily L domain-like 1.49e-42
Family Ngr ectodomain-like 0.00031
Further Details:      
 
Domain Number 4 Region: 1-107
Classification Level Classification E-value
Superfamily L domain-like 4.01e-27
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 5 Region: 868-910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 785-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000884
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 946-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000526
Family EGF-type module 0.021
Further Details:      
 
Domain Number 8 Region: 827-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000188
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 906-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000272
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 1282-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000734
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053488   Gene: ENSBTAG00000043991   Transcript: ENSBTAT00000061296
Sequence length 1396
Comment pep:known chromosome:UMD3.1:26:18136427:18196310:-1 gene:ENSBTAG00000043991 transcript:ENSBTAT00000061296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENTIQAIPRKAFRGATDLKNLQLDKNQIGCIEEGAFRALRGLEVLTLNNNNITTIPV
SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQCSGPAGLRGLNVAEVQK
SEFSCSGQGEAGRTPSCTLSSGSCPAMCACSNGIVDCRGKGLTAIPANLPEAMTEIRLEL
NGIKSIPPGAFSPYRKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPQGVFG
GLFTLQLLLLNANKINCIRLDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQ
NPFICDCNLKWLADFLRSNPIETSGARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGA
EDYQLNSECNSDVVCPHKCRCEASMVECSSLKLTKIPERVPQATAELRLNNNEISILEAT
GMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLEGLRTL
MLRNNRISCIHNDSFTGLRNVRLLSLYDNQIATISPGAFDTLQALSTLNLLANPFNCNCQ
LAWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVASPDFRCEEGQEEGGCLPRPQCPQEC
ACLDTVVRCSNKHLQTLPKGIPKNVTELYLDGNQFTLVPAQLSTFKYLQLVDLSNNKISS
LSNSSFTNMSQLTTLILSYNSLQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSL
SHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPLDMEGKLLLTTPAKKFECQGPP
TLTVQAKCDPCLSSPCQNQGTCRNDPLVGYRCACPSGYKGRDCEVSLDSCSSSPCGNGGT
CRSQEGEDAGFTCSCPTGFEGPTCGVDTDDCVEHSCANGGTCVDGVGSYTCQCPLQYSGR
ACELLVDFCAPDLNPCQHEAQCVGTPDGPRCECAPGYAGGNCTEKQDDCRDHRCQNGAQC
VDEANGYSCLCTQGYSGQLCETPPRPPGPRSPCEGTECQNGANCVDQGNGPVCQCLPGFG
GPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGILLYNGDNDHIAVELYQ
GHVRVSYDPGSYPSSAIYSTETINDGQFHTVELVTFDQMVNLSIDGGSPMTMDNFGKHYT
LNSDAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTRMKPGVVPG
CEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPADGPCHGHKCVHGKCVPLDALS
YSCQCQDGYSGALCNQAGAPADPCEGLRCLHGHCQASATKGTYCVCDPGFSGELCEQESE
CRGDPVRDFHQVQRGYAICRTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSF
AEEVEKPTKCGCALCA
Download sequence
Identical sequences E1BP10
ENSBTAP00000053488 ENSBTAP00000053488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]