SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053634 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053634
Domain Number 1 Region: 336-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.92e-70
Family Hemopexin-like domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.56e-55
Family Matrix metalloproteases, catalytic domain 0.0000000577
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 4.55e-21
Family MMP N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053634   Gene: ENSBTAG00000006877   Transcript: ENSBTAT00000061368
Sequence length 607
Comment pep:known chromosome:UMD3.1:14:76757695:77111545:1 gene:ENSBTAG00000006877 transcript:ENSBTAT00000061368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLTSSTGRRLDFVHHSGILYLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPSDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPSDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSVPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNHRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDREK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences F1N797
ENSBTAP00000053634 9913.ENSBTAP00000053634 NP_001179551.1.59421 NP_001179551.1.76553 XP_005888339.1.15283 XP_010860419.1.44457 XP_019829493.1.53367 ENSBTAP00000053634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]