SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054815 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054815
Domain Number 1 Region: 630-697
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000178
Family VWC domain 0.0052
Further Details:      
 
Domain Number 2 Region: 1548-1620
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000136
Family VWC domain 0.014
Further Details:      
 
Domain Number 3 Region: 410-475
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000335
Family VWC domain 0.011
Further Details:      
 
Domain Number 4 Region: 747-812
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000356
Family VWC domain 0.011
Further Details:      
 
Domain Number 5 Region: 925-991
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000398
Family VWC domain 0.012
Further Details:      
 
Domain Number 6 Region: 226-285
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000513
Family VWC domain 0.015
Further Details:      
 
Domain Number 7 Region: 114-170
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000356
Family VWC domain 0.018
Further Details:      
 
Domain Number 8 Region: 1085-1150
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000617
Family VWC domain 0.017
Further Details:      
 
Domain Number 9 Region: 355-419
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000282
Family VWC domain 0.024
Further Details:      
 
Domain Number 10 Region: 1305-1363
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000732
Family VWC domain 0.0063
Further Details:      
 
Domain Number 11 Region: 1484-1555
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000398
Family VWC domain 0.092
Further Details:      
 
Domain Number 12 Region: 176-225
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000743
Family VWC domain 0.0032
Further Details:      
 
Domain Number 13 Region: 573-637
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000115
Family VWC domain 0.0033
Further Details:      
 
Domain Number 14 Region: 1357-1432
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000115
Family VWC domain 0.01
Further Details:      
 
Domain Number 15 Region: 868-922
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000303
Family VWC domain 0.081
Further Details:      
 
Domain Number 16 Region: 515-577
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000314
Family VWC domain 0.033
Further Details:      
 
Domain Number 17 Region: 1889-1954
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000441
Family ATI-like 0.037
Further Details:      
 
Domain Number 18 Region: 692-749
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000068
Family VWC domain 0.032
Further Details:      
 
Domain Number 19 Region: 1440-1494
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000963
Family VWC domain 0.0077
Further Details:      
 
Domain Number 20 Region: 68-109
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000115
Family VWC domain 0.051
Further Details:      
 
Domain Number 21 Region: 828-874
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000398
Family VWC domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054815   Gene: ENSBTAG00000003449   Transcript: ENSBTAT00000066110
Sequence length 1978
Comment pep:known chromosome:UMD3.1:4:93655277:93682583:-1 gene:ENSBTAG00000003449 transcript:ENSBTAT00000066110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISREPLGLADIQDYQSEGPAHSSAPAGVPEEWWRPLEEQLERLEAEVTELREQNKDLQGR
VTQLESCECHPASPQCWGLGRAWPEGARWEPDACTACVCQDGAANCVPKPGLARCHGCSH
NGQAYGNGETFTPDACTICRCLEGAVTCTQKPCPRGPCQEPGACCPHCEPGCPGGYRDGE
MWQLERCVICTCQAGTVRCQGPSCSELNCLESYTPPGECCPVCRPGCEYEGQLYEEGANF
WSSSNPCLQCSCLRSLVRCVPTKCPPIPCPKPVLRPGHCCPTCQGESPCPFPGGAPGCFI
NPELTLQTPDLGVSSAGEPGPFGTDTPCEVGVCWLGRRRLVGVAYTERLLLCLSPPAQGC
TENGSHWEHGQEWTTPGDPCRICQCLEGHILCRQRECASLCPYPARPLPGTCCPVCDGCF
LNGRDYRSGEPVGSGDPCSRCRCVNGSVQCEPPPCPPTPCRHPGRTPGECCPVCDREALG
LGVGVVASTEPTEAPLNQPKLCHQGPQPCPPAPLSSCPGCEYQGHKYQNQETFQLQESGR
CAHCSCQAGEVSCEERECPGMPCTLPDSGPEPCSGVCIVCVLDEEEFAEGVQWEPDGQPC
TTCSCQAGVPVCGTLLCSPAPCQHPTQPPGACCPSCENCTYHGQVYANGQNFTDADPCHT
CHCEDGTVTCSLVNCPPTTCARPQRGPSQCCPRCPDCVLEKQVFLDGERFSHPRDPCQEC
QCREGHAHCQPRLCPRTSCAHPLPGVCCQNNCNGCAFGGKEYPNGADFPHPSDPCRLCHC
LGGTVQCLARRCPPLPCPEPVLLPRQCCPRCPAAPSGCPRPGGLVPAHHQEYFSPPDDPC
RRCLCLDGSVSCRRLPCPPVPCTHPHQGPCCPSCDGCLYQGKEFTSGERFPSPTARCHIC
LCWEGSISCEPRACAPAQCPFPAQGDCCPACDGCEYLGESYLSGQEFPDPREPCNLCTCL
GGFVTCGRRPCEPLGCSHPLTRAGHCCPTCQGCLYHGVTAAPGETLPDPLDPACSLCTCQ
VCRGQGRGSVQVLPTEGPCAALFEGVMIRGSGCGRATSLPQEGSMRCQKKPCPPALCPRP
SSGPCFCPVCHSCLSQGQEHQDGEEFEGPTGSCERCLCQAGQVSCVRQRCPPLSCPLQVT
EPGSCCPRCRAFPPPCPPFWPAHTSGLELSPCPPSSLPSCSCPWPAQPISPSRFLLEYPQ
SYPVPNHTPSYEEDPNPIHCPKWYKNHEYLLDGTFHSSAGYCCWCWAVTGSAYCRARFCP
SFLLQPRRSPSWLPTCPTDYAEWGRGSGQTCRTQTQSSPLPTLDTGCLFHGEEHPEGSSW
KPPDSPCSSCMCHEGVITCARIQCVTSCAQPHQGPSDCCPRCSDCEHEGRKYEPGESFQP
GADPCEVCVCELQPEGTPSLRCHRRQCPHLAGCPTSQLLTPGPQQCCPTCAEALSHCTEH
LLGSELTPPDPCYSCQCQDLTWLCIHRACPELSCPLPERYIPPGSCCPMCQDCVVEAAGR
TAADGESWRDPSNACVTCTCRRGHVECRLEECQALTCPRGWAKVREAGRCCERCQAPAPS
CAHQGRQVASGERWDVDACTNCSCMAGTVRCQSQRCPPLSCGPDEAPALSPGSCCPRCLP
RPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCRGGDFSVHVTNDDRGRSGVSWTQEV
AVLLGDVAVRLLQDRAVTVDGRPVALPFLQEPLFYVELRGRTVVLHSQPGLQVLWDGRSQ
VEVRVPGSYRGHMCGLCGNFNGFAQDDLRDPEELLRSTEAAFGNSWQVPEGPGPGRPCSK
GREVDPCQAAGYRARREANARCAVLKSAPFSRCHAVVPPDPFFAACVYDLCACGPGSSSD
ACLCDALEAYASHCRQAGVTPAWRGPTLCVVGCPLDRGFVFDECGPPCPRTCFNKHVPLG
ELAAHCVRPCIPSCQCPAGLVEHEGHCISPEACPSVLLTGDQLPSTPRNPSQELQGPT
Download sequence
Identical sequences G3MZ24
ENSBTAP00000054815 ENSBTAP00000054815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]