SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055505 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055505
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-50
Family Allantoicase repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 215-393
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-47
Family Allantoicase repeat 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055505   Gene: ENSBTAG00000013838   Transcript: ENSBTAT00000065445
Sequence length 417
Comment pep:known chromosome:UMD3.1:8:112837179:112860706:-1 gene:ENSBTAG00000013838 transcript:ENSBTAT00000065445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSPREGKVARPPDFTQLIDLASEFVGGKILFATDDFFAPAENLLKRDNPSFKEHEYTE
FGKWMDGWQTRRKRIPGHDWCVVQLGIQGVIRGFDVDTSYFTGDHAPRVSIQAANFEEDK
QPEIPQREVRTGAAATPEEFEAISELKSDDWSCLVPMTELTLGVLCTNNPYFATNTSTAW
FHLLFKIYQWQLFPDGGIARLRVYGTGQKDWTAGDPKEPLDLVTVAYGGACVGFSNAHFG
HPNNLIGVGTATSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITQIE
IDTKYFKGNSPESCKVDGCILTTQEEEDMVRQKWDLPGHKWKPLLPVTKLKPDEMHVLDS
LTPELQDVITHAKFTITPDGGVSRLRLKGFPSSICLLRPREKPMMRFSVKAGFRANL
Download sequence
Identical sequences G3N0Y5
ENSBTAP00000055505 ENSBTAP00000055505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]