SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397677780|ref|YP_006519316.1| from Mycoplasma wenyonii str. Massachusetts

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397677780|ref|YP_006519316.1|
Domain Number - Region: 99-169
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.0144
Family Glucose permease domain IIB 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397677780|ref|YP_006519316.1|
Sequence length 183
Comment hypothetical protein WEN_00930 [Mycoplasma wenyonii str. Massachusetts]
Sequence
MKFFKRLALRLKATKRRILKRFKLFQLRILGFVYAIKSVVVSLFNVFILLPCTIVWKIFN
FFVWRHVVRFYKWFAKKTSFLRWKVSPFNVSEPEGERYALFLEVLGGWKNVLAFKCKAKS
WHLKIMHSFLIDWEKFPHFGIEVLVWEWPYLSLSVGSYSWWIYKRLERTTKMPKRIKKNK
DPF
Download sequence
Identical sequences I6ZEH1
gi|397677780|ref|YP_006519316.1| WP_014849697.1.71021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]