SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82699117|ref|YP_413691.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82699117|ref|YP_413691.1|
Domain Number 1 Region: 67-337
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.85e-70
Family L-arabinose binding protein-like 0.0000174
Further Details:      
 
Domain Number 2 Region: 6-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 6.09e-17
Family GalR/LacI-like bacterial regulator 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82699117|ref|YP_413691.1|
Sequence length 340
Comment transcriptional regulator LacI [Brucella melitensis biovar Abortus 2308]
Sequence
MAATGKRATIHDVARLAGVSIKTVSRVYNDEPNVREAIREKVKQAGAQLRYRPNVAARNL
VERRSHLIGLFFENPSSSYVTELQMGALERLRGTRYRLLIFPVENRADIRGALIETAHAS
GLDGIIVTPPMSDDPDILQELTASAMPFARVAGDANVHPTDSVTIDDEAAAVDLMNYLLE
LGHRKIAIVIGDPTHRSAELRLEGYRRALREAGIEGNSDYEVQGGFSFASGLVAGRKLLS
LPNRPTAIFASNDDMAAAVMQVAYDAGIAVPDDLTVVGFDDSAIATMVSPQITTVRQPIF
EMTRDAADMLLRQMESGETSPAQRIDYKLIVRQSSARVPA
Download sequence
Identical sequences A0A0E1X2D7 A0A0F6ANV4 A0A0H3AQD2 A0A0M1WCX2 A0A2I7WNI6 B0CJ62 C4IR40 C7LFQ9 C9V884 D7H1B6 N8NJ88 Q2YP65 Q57FH4
gi|560150287|ref|YP_008843081.1| gi|163842472|ref|YP_001626876.1| gi|189023452|ref|YP_001934220.1| 262698.BruAb1_0200 359391.BAB1_0206 430066.BAbS19_I01940 444178.BOV_0197 470137.BSUIS_A0206 568815.BMI_I209 WP_002965454.1.100204 WP_002965454.1.100443 WP_002965454.1.101150 WP_002965454.1.101247 WP_002965454.1.101965 WP_002965454.1.102082 WP_002965454.1.10630 WP_002965454.1.10893 WP_002965454.1.1158 WP_002965454.1.11620 WP_002965454.1.11769 WP_002965454.1.12241 WP_002965454.1.13460 WP_002965454.1.13576 WP_002965454.1.13826 WP_002965454.1.14507 WP_002965454.1.14542 WP_002965454.1.14633 WP_002965454.1.16975 WP_002965454.1.17378 WP_002965454.1.17733 WP_002965454.1.18034 WP_002965454.1.18635 WP_002965454.1.19641 WP_002965454.1.20012 WP_002965454.1.20827 WP_002965454.1.2214 WP_002965454.1.22583 WP_002965454.1.23458 WP_002965454.1.24196 WP_002965454.1.24428 WP_002965454.1.24496 WP_002965454.1.24655 WP_002965454.1.25101 WP_002965454.1.25382 WP_002965454.1.25561 WP_002965454.1.25729 WP_002965454.1.26599 WP_002965454.1.2778 WP_002965454.1.2839 WP_002965454.1.2874 WP_002965454.1.2877 WP_002965454.1.31094 WP_002965454.1.31106 WP_002965454.1.31239 WP_002965454.1.32337 WP_002965454.1.32731 WP_002965454.1.33220 WP_002965454.1.33599 WP_002965454.1.33753 WP_002965454.1.33907 WP_002965454.1.34353 WP_002965454.1.35970 WP_002965454.1.3681 WP_002965454.1.37797 WP_002965454.1.39021 WP_002965454.1.39039 WP_002965454.1.39963 WP_002965454.1.40138 WP_002965454.1.40407 WP_002965454.1.40624 WP_002965454.1.40649 WP_002965454.1.40871 WP_002965454.1.41044 WP_002965454.1.41835 WP_002965454.1.41893 WP_002965454.1.4207 WP_002965454.1.42071 WP_002965454.1.42427 WP_002965454.1.43597 WP_002965454.1.4428 WP_002965454.1.44793 WP_002965454.1.44949 WP_002965454.1.45546 WP_002965454.1.45559 WP_002965454.1.46182 WP_002965454.1.46432 WP_002965454.1.47558 WP_002965454.1.47610 WP_002965454.1.47843 WP_002965454.1.4847 WP_002965454.1.48744 WP_002965454.1.48948 WP_002965454.1.49427 WP_002965454.1.49640 WP_002965454.1.49942 WP_002965454.1.49953 WP_002965454.1.50051 WP_002965454.1.50053 WP_002965454.1.50282 WP_002965454.1.5052 WP_002965454.1.5236 WP_002965454.1.5307 WP_002965454.1.53128 WP_002965454.1.53481 WP_002965454.1.53843 WP_002965454.1.5394 WP_002965454.1.54440 WP_002965454.1.54779 WP_002965454.1.55440 WP_002965454.1.55684 WP_002965454.1.56334 WP_002965454.1.56683 WP_002965454.1.56947 WP_002965454.1.56952 WP_002965454.1.57925 WP_002965454.1.58525 WP_002965454.1.58539 WP_002965454.1.59086 WP_002965454.1.59515 WP_002965454.1.59985 WP_002965454.1.61536 WP_002965454.1.61811 WP_002965454.1.61997 WP_002965454.1.62872 WP_002965454.1.63730 WP_002965454.1.64124 WP_002965454.1.64853 WP_002965454.1.64905 WP_002965454.1.65131 WP_002965454.1.65454 WP_002965454.1.66260 WP_002965454.1.66340 WP_002965454.1.66810 WP_002965454.1.67402 WP_002965454.1.67893 WP_002965454.1.67996 WP_002965454.1.67997 WP_002965454.1.69451 WP_002965454.1.69829 WP_002965454.1.70296 WP_002965454.1.70322 WP_002965454.1.71194 WP_002965454.1.71846 WP_002965454.1.72439 WP_002965454.1.72533 WP_002965454.1.72916 WP_002965454.1.74005 WP_002965454.1.75458 WP_002965454.1.75766 WP_002965454.1.76350 WP_002965454.1.77165 WP_002965454.1.77321 WP_002965454.1.77683 WP_002965454.1.78109 WP_002965454.1.78225 WP_002965454.1.7984 WP_002965454.1.79963 WP_002965454.1.8012 WP_002965454.1.80266 WP_002965454.1.80697 WP_002965454.1.81027 WP_002965454.1.81617 WP_002965454.1.8224 WP_002965454.1.82565 WP_002965454.1.82595 WP_002965454.1.8278 WP_002965454.1.8307 WP_002965454.1.83161 WP_002965454.1.83513 WP_002965454.1.84512 WP_002965454.1.84540 WP_002965454.1.85322 WP_002965454.1.8657 WP_002965454.1.86923 WP_002965454.1.87222 WP_002965454.1.87603 WP_002965454.1.87867 WP_002965454.1.87893 WP_002965454.1.88404 WP_002965454.1.8878 WP_002965454.1.90027 WP_002965454.1.90420 WP_002965454.1.90689 WP_002965454.1.91123 WP_002965454.1.9163 WP_002965454.1.92518 WP_002965454.1.9303 WP_002965454.1.93230 WP_002965454.1.93454 WP_002965454.1.93795 WP_002965454.1.94126 WP_002965454.1.94513 WP_002965454.1.94648 WP_002965454.1.94770 WP_002965454.1.94775 WP_002965454.1.95148 WP_002965454.1.97511 WP_002965454.1.97741 WP_002965454.1.98076 WP_002965454.1.98455 WP_002965454.1.98704 WP_002965454.1.99221 WP_002965454.1.99373 WP_002965454.1.99421 gi|62289178|ref|YP_220971.1| gi|340789825|ref|YP_004755289.1| gi|256368667|ref|YP_003106173.1| gi|376271883|ref|YP_005150461.1| gi|148559565|ref|YP_001258232.1| gi|560147774|ref|YP_008840590.1| gi|82699117|ref|YP_413691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]