SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82699445|ref|YP_414019.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82699445|ref|YP_414019.1|
Domain Number 1 Region: 29-314
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.68e-57
Family L-arabinose binding protein-like 0.0000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82699445|ref|YP_414019.1|
Sequence length 320
Comment periplasmic binding protein/LacI transcriptional regulator [Brucella melitensis biovar Abortus 2308]
Sequence
MRRNLMKLAFAALTAGALAFAGAASAQDKKVTIGVSIPAADHGWTAGVVYHAERVAKLLM
EEHPGLNVIVKTSPDAASQANALQDLAVQGLDGLVVLPTDPDPLVNAIKEIKDKGTFVAL
VDRAPSNNDNTIRDLYVAGNKPALGQVAGEYIKATTPDAQVVVIRGLPIPIDQQRQDGFD
KGIEGSNVKVLDRQYGNWNRDDAFRVMQDFLTKYPKIDVVWAQDDDMLVGVLEAIKQSNR
SDIQYVVGGAGSKDMIKRVMDGDKLVPVDVLYPPAMVSTAMELAAGHFYDQIPVSGDYIL
DATLVTEDNAKDFYFPDSPF
Download sequence
Identical sequences A0A0F6APP6 A0A0M1WEV3 A0A1Z1ZK44 A0A2I7WPI0 C0RHP7 D7H299 Q2YMQ4 Q57EI7
gi|62289515|ref|YP_221308.1| gi|225852076|ref|YP_002732309.1| gi|82699445|ref|YP_414019.1| gi|189023770|ref|YP_001934538.1| 262698.BruAb1_0566 359391.BAB1_0567 430066.BAbS19_I05290 546272.BMEA_A0582 WP_002969455.1.100443 WP_002969455.1.100628 WP_002969455.1.100807 WP_002969455.1.101411 WP_002969455.1.101965 WP_002969455.1.102026 WP_002969455.1.102082 WP_002969455.1.10322 WP_002969455.1.1055 WP_002969455.1.10630 WP_002969455.1.10844 WP_002969455.1.10866 WP_002969455.1.10893 WP_002969455.1.11066 WP_002969455.1.11620 WP_002969455.1.11859 WP_002969455.1.11933 WP_002969455.1.12041 WP_002969455.1.12241 WP_002969455.1.12704 WP_002969455.1.12925 WP_002969455.1.12981 WP_002969455.1.1327 WP_002969455.1.13460 WP_002969455.1.13826 WP_002969455.1.14323 WP_002969455.1.14542 WP_002969455.1.14633 WP_002969455.1.15077 WP_002969455.1.16975 WP_002969455.1.17378 WP_002969455.1.18034 WP_002969455.1.18494 WP_002969455.1.18635 WP_002969455.1.19182 WP_002969455.1.19483 WP_002969455.1.19641 WP_002969455.1.20012 WP_002969455.1.22142 WP_002969455.1.22583 WP_002969455.1.2337 WP_002969455.1.23391 WP_002969455.1.24196 WP_002969455.1.24428 WP_002969455.1.24607 WP_002969455.1.24655 WP_002969455.1.24726 WP_002969455.1.24895 WP_002969455.1.24923 WP_002969455.1.24971 WP_002969455.1.25101 WP_002969455.1.25135 WP_002969455.1.25382 WP_002969455.1.25450 WP_002969455.1.25729 WP_002969455.1.26599 WP_002969455.1.2778 WP_002969455.1.27794 WP_002969455.1.2839 WP_002969455.1.2874 WP_002969455.1.2877 WP_002969455.1.28889 WP_002969455.1.29765 WP_002969455.1.29997 WP_002969455.1.31094 WP_002969455.1.31239 WP_002969455.1.31635 WP_002969455.1.31644 WP_002969455.1.31680 WP_002969455.1.32337 WP_002969455.1.32492 WP_002969455.1.32731 WP_002969455.1.32779 WP_002969455.1.33032 WP_002969455.1.33220 WP_002969455.1.33289 WP_002969455.1.33466 WP_002969455.1.33599 WP_002969455.1.33753 WP_002969455.1.34183 WP_002969455.1.34353 WP_002969455.1.34423 WP_002969455.1.35056 WP_002969455.1.35338 WP_002969455.1.35577 WP_002969455.1.35970 WP_002969455.1.36149 WP_002969455.1.36712 WP_002969455.1.37797 WP_002969455.1.38353 WP_002969455.1.39021 WP_002969455.1.39039 WP_002969455.1.39963 WP_002969455.1.40189 WP_002969455.1.40407 WP_002969455.1.40624 WP_002969455.1.40649 WP_002969455.1.40871 WP_002969455.1.4091 WP_002969455.1.41044 WP_002969455.1.41105 WP_002969455.1.41311 WP_002969455.1.41344 WP_002969455.1.42065 WP_002969455.1.42103 WP_002969455.1.42427 WP_002969455.1.42633 WP_002969455.1.42774 WP_002969455.1.4295 WP_002969455.1.43058 WP_002969455.1.43148 WP_002969455.1.4319 WP_002969455.1.43597 WP_002969455.1.44045 WP_002969455.1.44060 WP_002969455.1.4428 WP_002969455.1.44541 WP_002969455.1.45559 WP_002969455.1.46182 WP_002969455.1.46432 WP_002969455.1.4727 WP_002969455.1.47516 WP_002969455.1.47545 WP_002969455.1.47558 WP_002969455.1.47610 WP_002969455.1.48075 WP_002969455.1.48184 WP_002969455.1.48396 WP_002969455.1.4847 WP_002969455.1.48727 WP_002969455.1.49089 WP_002969455.1.49640 WP_002969455.1.50051 WP_002969455.1.50053 WP_002969455.1.50282 WP_002969455.1.5052 WP_002969455.1.50952 WP_002969455.1.51553 WP_002969455.1.5236 WP_002969455.1.52478 WP_002969455.1.52541 WP_002969455.1.53128 WP_002969455.1.53481 WP_002969455.1.5394 WP_002969455.1.54440 WP_002969455.1.54481 WP_002969455.1.55047 WP_002969455.1.55284 WP_002969455.1.55440 WP_002969455.1.55585 WP_002969455.1.55684 WP_002969455.1.5609 WP_002969455.1.56334 WP_002969455.1.56621 WP_002969455.1.56687 WP_002969455.1.56952 WP_002969455.1.57541 WP_002969455.1.57925 WP_002969455.1.58525 WP_002969455.1.58539 WP_002969455.1.59086 WP_002969455.1.59515 WP_002969455.1.60134 WP_002969455.1.60920 WP_002969455.1.61081 WP_002969455.1.61325 WP_002969455.1.61536 WP_002969455.1.61543 WP_002969455.1.61811 WP_002969455.1.61961 WP_002969455.1.61997 WP_002969455.1.62990 WP_002969455.1.62997 WP_002969455.1.63628 WP_002969455.1.63730 WP_002969455.1.64124 WP_002969455.1.6440 WP_002969455.1.64585 WP_002969455.1.64853 WP_002969455.1.64883 WP_002969455.1.64905 WP_002969455.1.65131 WP_002969455.1.65199 WP_002969455.1.65454 WP_002969455.1.65501 WP_002969455.1.65597 WP_002969455.1.65625 WP_002969455.1.66078 WP_002969455.1.66260 WP_002969455.1.66268 WP_002969455.1.66407 WP_002969455.1.66647 WP_002969455.1.66810 WP_002969455.1.66855 WP_002969455.1.67107 WP_002969455.1.67659 WP_002969455.1.67893 WP_002969455.1.67996 WP_002969455.1.67997 WP_002969455.1.68913 WP_002969455.1.6942 WP_002969455.1.69451 WP_002969455.1.69522 WP_002969455.1.69829 WP_002969455.1.69997 WP_002969455.1.70160 WP_002969455.1.70322 WP_002969455.1.70760 WP_002969455.1.71194 WP_002969455.1.71228 WP_002969455.1.71689 WP_002969455.1.71846 WP_002969455.1.7206 WP_002969455.1.72189 WP_002969455.1.72916 WP_002969455.1.73628 WP_002969455.1.73739 WP_002969455.1.7388 WP_002969455.1.74236 WP_002969455.1.75128 WP_002969455.1.75458 WP_002969455.1.75563 WP_002969455.1.75678 WP_002969455.1.75766 WP_002969455.1.76350 WP_002969455.1.7667 WP_002969455.1.76877 WP_002969455.1.77281 WP_002969455.1.77321 WP_002969455.1.77685 WP_002969455.1.78109 WP_002969455.1.78590 WP_002969455.1.79327 WP_002969455.1.7984 WP_002969455.1.79963 WP_002969455.1.79993 WP_002969455.1.80059 WP_002969455.1.80167 WP_002969455.1.80266 WP_002969455.1.80476 WP_002969455.1.80697 WP_002969455.1.81276 WP_002969455.1.81377 WP_002969455.1.81617 WP_002969455.1.81674 WP_002969455.1.81822 WP_002969455.1.82205 WP_002969455.1.8224 WP_002969455.1.82390 WP_002969455.1.82753 WP_002969455.1.8278 WP_002969455.1.82834 WP_002969455.1.82990 WP_002969455.1.8307 WP_002969455.1.84207 WP_002969455.1.84601 WP_002969455.1.84764 WP_002969455.1.85322 WP_002969455.1.85684 WP_002969455.1.85753 WP_002969455.1.85769 WP_002969455.1.8657 WP_002969455.1.86832 WP_002969455.1.86901 WP_002969455.1.87522 WP_002969455.1.87603 WP_002969455.1.87867 WP_002969455.1.8788 WP_002969455.1.88424 WP_002969455.1.88658 WP_002969455.1.8878 WP_002969455.1.88867 WP_002969455.1.89113 WP_002969455.1.90689 WP_002969455.1.9096 WP_002969455.1.91081 WP_002969455.1.91123 WP_002969455.1.91338 WP_002969455.1.91768 WP_002969455.1.92383 WP_002969455.1.92518 WP_002969455.1.93454 WP_002969455.1.94126 WP_002969455.1.94555 WP_002969455.1.94775 WP_002969455.1.95141 WP_002969455.1.95178 WP_002969455.1.95770 WP_002969455.1.96661 WP_002969455.1.96710 WP_002969455.1.97240 WP_002969455.1.97320 WP_002969455.1.97331 WP_002969455.1.97511 WP_002969455.1.97741 WP_002969455.1.97860 WP_002969455.1.98076 WP_002969455.1.98455 WP_002969455.1.98764 WP_002969455.1.99221 WP_002969455.1.99373 WP_002969455.1.99421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]