SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82699449|ref|YP_414023.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82699449|ref|YP_414023.1|
Domain Number 1 Region: 64-328
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.1e-33
Family L-arabinose binding protein-like 0.0045
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000113
Family GalR/LacI-like bacterial regulator 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82699449|ref|YP_414023.1|
Sequence length 343
Comment transcriptional regulator LacI [Brucella melitensis biovar Abortus 2308]
Sequence
MKPTVHDIARTAGVSLATVDRVLNDRPGVRAKTRDRVMAAMNMLGYVRDVGAANLARGRL
YQFDFILPDNENTFMLSLRSELYAASERALAERVRINLRLVPAFDEAALVAALDESAARK
PDGVAFVALDTDPVREGCARLAEKGIHAVTLVSDLGQSAREHYVGVDNGAAGRTAARLLG
LFANGTEGSIAVVAGSLKVRDHRERFDGFRAAMQADFPDREILPVLEGFDKDPQVEKLVG
EMLAKRSDIAGIYSLGAGNSGLVAALSAHKANHPLVIAHERDEITLKALEDGIIHAILAQ
DAGHEIRSAIRVLKASADRLAIVPGQEYIRIEIFLKDNLPRFN
Download sequence
Identical sequences A0A0F6APQ0 A0A0M1WEU9 A0A2K4NIL4 C4IPL3 D7H2A3 Q2YMQ0 Q57EI2
gi|82699449|ref|YP_414023.1| WP_002963699.1.100443 WP_002963699.1.101965 WP_002963699.1.102082 WP_002963699.1.10322 WP_002963699.1.10630 WP_002963699.1.10893 WP_002963699.1.11620 WP_002963699.1.12041 WP_002963699.1.12241 WP_002963699.1.13460 WP_002963699.1.13826 WP_002963699.1.14542 WP_002963699.1.14633 WP_002963699.1.15077 WP_002963699.1.16975 WP_002963699.1.17378 WP_002963699.1.18034 WP_002963699.1.18635 WP_002963699.1.19641 WP_002963699.1.20012 WP_002963699.1.22583 WP_002963699.1.2337 WP_002963699.1.24196 WP_002963699.1.24428 WP_002963699.1.24655 WP_002963699.1.24726 WP_002963699.1.25101 WP_002963699.1.25382 WP_002963699.1.25729 WP_002963699.1.2778 WP_002963699.1.2877 WP_002963699.1.28889 WP_002963699.1.32492 WP_002963699.1.32731 WP_002963699.1.33220 WP_002963699.1.33599 WP_002963699.1.33753 WP_002963699.1.34353 WP_002963699.1.35056 WP_002963699.1.35970 WP_002963699.1.37797 WP_002963699.1.38353 WP_002963699.1.39021 WP_002963699.1.39039 WP_002963699.1.39963 WP_002963699.1.40407 WP_002963699.1.40649 WP_002963699.1.40871 WP_002963699.1.41311 WP_002963699.1.42103 WP_002963699.1.42427 WP_002963699.1.43597 WP_002963699.1.4428 WP_002963699.1.45559 WP_002963699.1.46182 WP_002963699.1.46432 WP_002963699.1.4727 WP_002963699.1.47558 WP_002963699.1.47610 WP_002963699.1.4847 WP_002963699.1.49640 WP_002963699.1.50051 WP_002963699.1.50053 WP_002963699.1.50282 WP_002963699.1.5236 WP_002963699.1.53481 WP_002963699.1.5394 WP_002963699.1.54440 WP_002963699.1.55440 WP_002963699.1.56334 WP_002963699.1.56952 WP_002963699.1.57925 WP_002963699.1.58525 WP_002963699.1.58539 WP_002963699.1.59086 WP_002963699.1.59515 WP_002963699.1.61325 WP_002963699.1.61536 WP_002963699.1.61811 WP_002963699.1.61997 WP_002963699.1.63730 WP_002963699.1.64124 WP_002963699.1.64853 WP_002963699.1.64905 WP_002963699.1.65131 WP_002963699.1.65454 WP_002963699.1.65625 WP_002963699.1.66260 WP_002963699.1.66810 WP_002963699.1.67996 WP_002963699.1.68913 WP_002963699.1.69451 WP_002963699.1.69829 WP_002963699.1.70322 WP_002963699.1.71194 WP_002963699.1.71689 WP_002963699.1.71846 WP_002963699.1.7206 WP_002963699.1.72916 WP_002963699.1.75458 WP_002963699.1.75766 WP_002963699.1.76350 WP_002963699.1.76433 WP_002963699.1.77321 WP_002963699.1.78109 WP_002963699.1.7984 WP_002963699.1.79963 WP_002963699.1.80266 WP_002963699.1.80476 WP_002963699.1.80697 WP_002963699.1.81822 WP_002963699.1.8224 WP_002963699.1.8278 WP_002963699.1.8307 WP_002963699.1.85322 WP_002963699.1.85769 WP_002963699.1.87522 WP_002963699.1.87603 WP_002963699.1.87867 WP_002963699.1.8788 WP_002963699.1.8878 WP_002963699.1.90689 WP_002963699.1.91123 WP_002963699.1.91338 WP_002963699.1.92518 WP_002963699.1.93454 WP_002963699.1.94126 WP_002963699.1.94555 WP_002963699.1.97511 WP_002963699.1.98076 WP_002963699.1.98455 WP_002963699.1.99221 262698.BruAb1_0571 359391.BAB1_0572 430066.BAbS19_I05340 gi|62289520|ref|YP_221313.1| gi|189023775|ref|YP_001934543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]