SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82700119|ref|YP_414693.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82700119|ref|YP_414693.1|
Domain Number 1 Region: 30-360
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-47
Family L-arabinose binding protein-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82700119|ref|YP_414693.1|
Sequence length 363
Comment Leu/Ile/Val-binding family protein [Brucella melitensis biovar Abortus 2308]
Sequence
MIAPGKCPATVLLTSIVLSWLASGTLAQAEDVRVGLAAPLSGTFAPLGNQLVEGARAAAG
TGVQLTVFDDRCDAEGGKEAAERFVEQNIRIATGFLCPEALETALPILSQRNIPIIISDV
SELTLAERRAASPLPTFRLTTGLNKETQATGSFLGSLWRAQPFAIIDDGTIEGRERAARV
LANLKEQQLQPVFTDTYRPGLDKQNALVSRLRRAGATHVYVGGERDDIAAIGASAAALNY
PLVIAGGSLLDAAPGPHPLAQGTLMIAPVRPSDLSTAKPAIDALHQADKLADSYAIIGYA
SVEIADEAIKRADEQKQPIINLLRSGSFETALGTIKFDENGIRTDNPNRLQRFDGKRFIL
TDK
Download sequence
Identical sequences A0A0M1WBK7 A0A2I7WRL4 Q2YQM0 Q57CK5
gi|62290197|ref|YP_221990.1| gi|82700119|ref|YP_414693.1| 262698.BruAb1_1294 359391.BAB1_1313 WP_002969559.1.100443 WP_002969559.1.101965 WP_002969559.1.102082 WP_002969559.1.10322 WP_002969559.1.10630 WP_002969559.1.10893 WP_002969559.1.11620 WP_002969559.1.12041 WP_002969559.1.12241 WP_002969559.1.13460 WP_002969559.1.13826 WP_002969559.1.14542 WP_002969559.1.14633 WP_002969559.1.15077 WP_002969559.1.16975 WP_002969559.1.17378 WP_002969559.1.18034 WP_002969559.1.18635 WP_002969559.1.19641 WP_002969559.1.20012 WP_002969559.1.22583 WP_002969559.1.2337 WP_002969559.1.24196 WP_002969559.1.24428 WP_002969559.1.24655 WP_002969559.1.24726 WP_002969559.1.25101 WP_002969559.1.25382 WP_002969559.1.25729 WP_002969559.1.26599 WP_002969559.1.2778 WP_002969559.1.2839 WP_002969559.1.2874 WP_002969559.1.2877 WP_002969559.1.28889 WP_002969559.1.31239 WP_002969559.1.32337 WP_002969559.1.32492 WP_002969559.1.32731 WP_002969559.1.33220 WP_002969559.1.33599 WP_002969559.1.33753 WP_002969559.1.34353 WP_002969559.1.35056 WP_002969559.1.35970 WP_002969559.1.37797 WP_002969559.1.38353 WP_002969559.1.39021 WP_002969559.1.39039 WP_002969559.1.39963 WP_002969559.1.40407 WP_002969559.1.40624 WP_002969559.1.40649 WP_002969559.1.40871 WP_002969559.1.41044 WP_002969559.1.41311 WP_002969559.1.42103 WP_002969559.1.42427 WP_002969559.1.43597 WP_002969559.1.4428 WP_002969559.1.45559 WP_002969559.1.46182 WP_002969559.1.46432 WP_002969559.1.4727 WP_002969559.1.47558 WP_002969559.1.47610 WP_002969559.1.4847 WP_002969559.1.49640 WP_002969559.1.50051 WP_002969559.1.50053 WP_002969559.1.50282 WP_002969559.1.5052 WP_002969559.1.5236 WP_002969559.1.53128 WP_002969559.1.53481 WP_002969559.1.5394 WP_002969559.1.54440 WP_002969559.1.55440 WP_002969559.1.55684 WP_002969559.1.56334 WP_002969559.1.56952 WP_002969559.1.57925 WP_002969559.1.58525 WP_002969559.1.58539 WP_002969559.1.59086 WP_002969559.1.59515 WP_002969559.1.61325 WP_002969559.1.61536 WP_002969559.1.61811 WP_002969559.1.61997 WP_002969559.1.63730 WP_002969559.1.64124 WP_002969559.1.64853 WP_002969559.1.64905 WP_002969559.1.65131 WP_002969559.1.65454 WP_002969559.1.65625 WP_002969559.1.66260 WP_002969559.1.66810 WP_002969559.1.67893 WP_002969559.1.67996 WP_002969559.1.67997 WP_002969559.1.68913 WP_002969559.1.69451 WP_002969559.1.69829 WP_002969559.1.70322 WP_002969559.1.71194 WP_002969559.1.71689 WP_002969559.1.71846 WP_002969559.1.7206 WP_002969559.1.72916 WP_002969559.1.75458 WP_002969559.1.75766 WP_002969559.1.76350 WP_002969559.1.77321 WP_002969559.1.78109 WP_002969559.1.79963 WP_002969559.1.80266 WP_002969559.1.80476 WP_002969559.1.80697 WP_002969559.1.81617 WP_002969559.1.81822 WP_002969559.1.8224 WP_002969559.1.8278 WP_002969559.1.8307 WP_002969559.1.85322 WP_002969559.1.85769 WP_002969559.1.8657 WP_002969559.1.87522 WP_002969559.1.87603 WP_002969559.1.87867 WP_002969559.1.8788 WP_002969559.1.8878 WP_002969559.1.90689 WP_002969559.1.91123 WP_002969559.1.91338 WP_002969559.1.92518 WP_002969559.1.93454 WP_002969559.1.94126 WP_002969559.1.94555 WP_002969559.1.94775 WP_002969559.1.97511 WP_002969559.1.97741 WP_002969559.1.98076 WP_002969559.1.98455 WP_002969559.1.99221 WP_002969559.1.99373 WP_002969559.1.99421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]