SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82700567|ref|YP_415141.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82700567|ref|YP_415141.1|
Domain Number 1 Region: 24-367
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.77e-92
Family L-arabinose binding protein-like 0.000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82700567|ref|YP_415141.1|
Sequence length 371
Comment Leu/Ile/Val-binding family protein [Brucella melitensis biovar Abortus 2308]
Sequence
MRKTLFSGVALAAVIAFGGSAWADVLVGIGIPVTGPNAVYGAQIQKGAEAAIKEVNDAGG
INGEKIAITIGDDVSDPKQGISVANKFAADGVKFVIGHFNSGVTIPASQVYAENGILEIS
PGATNPQYTEQGLWNTFRTCGRDDQQGTVAGQYIFDHFKDAKIAVIHDKTPYGQGLADET
KKKLNELGTKETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGMHPEAGLLIRQMADQGL
KAQFISGDGIVSNELASIAGDAVAGVMNTFGPDPRDDKANAELIKAFRDKGFEPEAYTLY
SYAAVQSLAQAAKAAGSNDPQEVAKAMKEKGPFKTVLGDLSYDEKGDPKLPGYVMYKWEK
GADGKYNYIQQ
Download sequence
Identical sequences A0A0F6ASE0 A0A0M1WAP3 A0A2I7WSF6 Q2YLF8 Q57B99
gi|62290653|ref|YP_222446.1| gi|189024864|ref|YP_001935632.1| 262698.BruAb1_1767 359391.BAB1_1794 430066.BAbS19_I16760 WP_002966965.1.100443 WP_002966965.1.102082 WP_002966965.1.10630 WP_002966965.1.11620 WP_002966965.1.12241 WP_002966965.1.13460 WP_002966965.1.13826 WP_002966965.1.14633 WP_002966965.1.16975 WP_002966965.1.19641 WP_002966965.1.20012 WP_002966965.1.22583 WP_002966965.1.24196 WP_002966965.1.24428 WP_002966965.1.24655 WP_002966965.1.25382 WP_002966965.1.26599 WP_002966965.1.2778 WP_002966965.1.2839 WP_002966965.1.2874 WP_002966965.1.31239 WP_002966965.1.32337 WP_002966965.1.33599 WP_002966965.1.33753 WP_002966965.1.35970 WP_002966965.1.39039 WP_002966965.1.39963 WP_002966965.1.40407 WP_002966965.1.40624 WP_002966965.1.40649 WP_002966965.1.40871 WP_002966965.1.41044 WP_002966965.1.42427 WP_002966965.1.4428 WP_002966965.1.45559 WP_002966965.1.46182 WP_002966965.1.46432 WP_002966965.1.47558 WP_002966965.1.47610 WP_002966965.1.50051 WP_002966965.1.50053 WP_002966965.1.50282 WP_002966965.1.5236 WP_002966965.1.53128 WP_002966965.1.53481 WP_002966965.1.5394 WP_002966965.1.54440 WP_002966965.1.55440 WP_002966965.1.55684 WP_002966965.1.56952 WP_002966965.1.57925 WP_002966965.1.58539 WP_002966965.1.59086 WP_002966965.1.61536 WP_002966965.1.61811 WP_002966965.1.61997 WP_002966965.1.63730 WP_002966965.1.64124 WP_002966965.1.64905 WP_002966965.1.65131 WP_002966965.1.65454 WP_002966965.1.66810 WP_002966965.1.67893 WP_002966965.1.67996 WP_002966965.1.67997 WP_002966965.1.69829 WP_002966965.1.70322 WP_002966965.1.71194 WP_002966965.1.71846 WP_002966965.1.72916 WP_002966965.1.75458 WP_002966965.1.76350 WP_002966965.1.77321 WP_002966965.1.78109 WP_002966965.1.79963 WP_002966965.1.80266 WP_002966965.1.80697 WP_002966965.1.81617 WP_002966965.1.8224 WP_002966965.1.8307 WP_002966965.1.8657 WP_002966965.1.87603 WP_002966965.1.87867 WP_002966965.1.8878 WP_002966965.1.90689 WP_002966965.1.91123 WP_002966965.1.91338 WP_002966965.1.92518 WP_002966965.1.93454 WP_002966965.1.94126 WP_002966965.1.94775 WP_002966965.1.97511 WP_002966965.1.97741 WP_002966965.1.98076 WP_002966965.1.99421 gi|82700567|ref|YP_415141.1| gi|376272494|ref|YP_005151072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]