SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82700808|ref|YP_415382.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82700808|ref|YP_415382.1|
Domain Number 1 Region: 28-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.32e-22
Family L-arabinose binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82700808|ref|YP_415382.1|
Sequence length 321
Comment hypothetical protein BAB1_2054 [Brucella melitensis biovar Abortus 2308]
Sequence
MRFKFRSMLLASLAAAAIATTAQAKDVTVAVTAIVEHPALDAARDGVKDALAEAGYKEGE
NLKFIYQSAQGNPATAAQIARQFVGEGPDVIVPISTPSAQAVVSATRDIPVVFTAVSDPV
GAQLVKDLKKPGGNVTGLSDMSPVVEHIKLIKEVMPNIKKLGYLYNSGETNSVSLLAALK
EAATAEGIEIVESAATKSAEVQGAARALVGRADAMYVPTDNTIVSALESAVGVAEESKLP
LFTADTDSVKRGALAALGFNYYDVGKQTGAIVVKILKGEKPGDIAVDIAKGTDLVINLGA
AKKMGVEFPQAVIDRATSKID
Download sequence
Identical sequences A0A0F6ASZ9 A0A0M1WC46 A0A2K4NMK6 D7H0F4 Q2YR20 Q57AK5
gi|62290897|ref|YP_222690.1| WP_002965117.1.100443 WP_002965117.1.101965 WP_002965117.1.102082 WP_002965117.1.10322 WP_002965117.1.10630 WP_002965117.1.10893 WP_002965117.1.11620 WP_002965117.1.12041 WP_002965117.1.12241 WP_002965117.1.13460 WP_002965117.1.13826 WP_002965117.1.14542 WP_002965117.1.14633 WP_002965117.1.15077 WP_002965117.1.16975 WP_002965117.1.17378 WP_002965117.1.18034 WP_002965117.1.18635 WP_002965117.1.19641 WP_002965117.1.20012 WP_002965117.1.22583 WP_002965117.1.2337 WP_002965117.1.24196 WP_002965117.1.24428 WP_002965117.1.24655 WP_002965117.1.24726 WP_002965117.1.25101 WP_002965117.1.25382 WP_002965117.1.25729 WP_002965117.1.26599 WP_002965117.1.2778 WP_002965117.1.2839 WP_002965117.1.2874 WP_002965117.1.2877 WP_002965117.1.28889 WP_002965117.1.31094 WP_002965117.1.31106 WP_002965117.1.31239 WP_002965117.1.32337 WP_002965117.1.32492 WP_002965117.1.32731 WP_002965117.1.33220 WP_002965117.1.33599 WP_002965117.1.33753 WP_002965117.1.34353 WP_002965117.1.35056 WP_002965117.1.35970 WP_002965117.1.37797 WP_002965117.1.38353 WP_002965117.1.39021 WP_002965117.1.39039 WP_002965117.1.39963 WP_002965117.1.40407 WP_002965117.1.40624 WP_002965117.1.40649 WP_002965117.1.40871 WP_002965117.1.41044 WP_002965117.1.41311 WP_002965117.1.41835 WP_002965117.1.42103 WP_002965117.1.42427 WP_002965117.1.43597 WP_002965117.1.4428 WP_002965117.1.45559 WP_002965117.1.46182 WP_002965117.1.46432 WP_002965117.1.4727 WP_002965117.1.47558 WP_002965117.1.47610 WP_002965117.1.4847 WP_002965117.1.49640 WP_002965117.1.50051 WP_002965117.1.50053 WP_002965117.1.50282 WP_002965117.1.5052 WP_002965117.1.5236 WP_002965117.1.53128 WP_002965117.1.53481 WP_002965117.1.5394 WP_002965117.1.54440 WP_002965117.1.54779 WP_002965117.1.55440 WP_002965117.1.55684 WP_002965117.1.56334 WP_002965117.1.56683 WP_002965117.1.56952 WP_002965117.1.57925 WP_002965117.1.58525 WP_002965117.1.58539 WP_002965117.1.59086 WP_002965117.1.59515 WP_002965117.1.61325 WP_002965117.1.61536 WP_002965117.1.61811 WP_002965117.1.61997 WP_002965117.1.63730 WP_002965117.1.64124 WP_002965117.1.64853 WP_002965117.1.64905 WP_002965117.1.65131 WP_002965117.1.65454 WP_002965117.1.65625 WP_002965117.1.66260 WP_002965117.1.66810 WP_002965117.1.67893 WP_002965117.1.67996 WP_002965117.1.67997 WP_002965117.1.68913 WP_002965117.1.69451 WP_002965117.1.69829 WP_002965117.1.70322 WP_002965117.1.71689 WP_002965117.1.71846 WP_002965117.1.7206 WP_002965117.1.72916 WP_002965117.1.75458 WP_002965117.1.75766 WP_002965117.1.76350 WP_002965117.1.76433 WP_002965117.1.77321 WP_002965117.1.78109 WP_002965117.1.7984 WP_002965117.1.79963 WP_002965117.1.80266 WP_002965117.1.80476 WP_002965117.1.80697 WP_002965117.1.81617 WP_002965117.1.81822 WP_002965117.1.8224 WP_002965117.1.8278 WP_002965117.1.8307 WP_002965117.1.85322 WP_002965117.1.85769 WP_002965117.1.8657 WP_002965117.1.87522 WP_002965117.1.87603 WP_002965117.1.87867 WP_002965117.1.8788 WP_002965117.1.8878 WP_002965117.1.90689 WP_002965117.1.91123 WP_002965117.1.91338 WP_002965117.1.92518 WP_002965117.1.93454 WP_002965117.1.93795 WP_002965117.1.94126 WP_002965117.1.94555 WP_002965117.1.94775 WP_002965117.1.97511 WP_002965117.1.97741 WP_002965117.1.98076 WP_002965117.1.98455 WP_002965117.1.99221 WP_002965117.1.99373 WP_002965117.1.99421 262698.BruAb1_2028 359391.BAB1_2054 430066.BAbS19_I19230 gi|189025111|ref|YP_001935879.1| gi|82700808|ref|YP_415382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]