SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83269293|ref|YP_418584.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83269293|ref|YP_418584.1|
Domain Number 1 Region: 31-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.98e-69
Family L-arabinose binding protein-like 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83269293|ref|YP_418584.1|
Sequence length 315
Comment periplasmic binding protein/LacI transcriptional regulator [Brucella melitensis biovar Abortus 2308]
Sequence
MFKKGMRVLFAAAAALPLIASTAWAEGLMTIIVNDPSNPYWFTEGEVAKKTAEGLGYKAV
VGGHKGDTNTESNLIDTAITNKSVAIILDPANADGSVGAVKRAIAANIPVFLINAEINQE
GLAKAQLVSNNAQGAALGATQWVESVGDKGKYVELFGAPSDNNAATRSNGYETVLSQYPD
LVRVGKDVANWDRTQGHDKMQALLQANPDIIGVISGNDEMALGAIAALKKAGKLDQVKVG
GFDGSPDAIAAIKAGELQYTVLQPVAVFSEAAVKQADNFIKTGKTGVDHEKQLFDCILIT
KDNVDKYTSPFVLEQ
Download sequence
Identical sequences A0A0E1X691 A0A0F6AU58 A0A0M1WHC9 A0A1G4EYJ8 A0A1M4LFF6 A0A1P8S9Q5 A0A2I7WUU5 C0GAJ8 C4IV05 C9V500 D0RF32 D7H6I1 E2PMR0 Q2YIY2 Q578Y0
gi|189022569|ref|YP_001932310.1| gi|340792635|ref|YP_004758099.1| gi|83269293|ref|YP_418584.1| 262698.BruAb2_0373 359391.BAB2_0377 430066.BAbS19_II03550 WP_002965789.1.101965 WP_002965789.1.102082 WP_002965789.1.10322 WP_002965789.1.10630 WP_002965789.1.10893 WP_002965789.1.11306 WP_002965789.1.11620 WP_002965789.1.12041 WP_002965789.1.12241 WP_002965789.1.13460 WP_002965789.1.13826 WP_002965789.1.14542 WP_002965789.1.14633 WP_002965789.1.15077 WP_002965789.1.17378 WP_002965789.1.18034 WP_002965789.1.18635 WP_002965789.1.19508 WP_002965789.1.19641 WP_002965789.1.20012 WP_002965789.1.20317 WP_002965789.1.21149 WP_002965789.1.22583 WP_002965789.1.2337 WP_002965789.1.24196 WP_002965789.1.24428 WP_002965789.1.24655 WP_002965789.1.24726 WP_002965789.1.25101 WP_002965789.1.25382 WP_002965789.1.25561 WP_002965789.1.25729 WP_002965789.1.26599 WP_002965789.1.27564 WP_002965789.1.2778 WP_002965789.1.2839 WP_002965789.1.2877 WP_002965789.1.28889 WP_002965789.1.29336 WP_002965789.1.31094 WP_002965789.1.31106 WP_002965789.1.31239 WP_002965789.1.32492 WP_002965789.1.32731 WP_002965789.1.33220 WP_002965789.1.33599 WP_002965789.1.33753 WP_002965789.1.34353 WP_002965789.1.35056 WP_002965789.1.35970 WP_002965789.1.3681 WP_002965789.1.37797 WP_002965789.1.38353 WP_002965789.1.39021 WP_002965789.1.39039 WP_002965789.1.39963 WP_002965789.1.40138 WP_002965789.1.40407 WP_002965789.1.40649 WP_002965789.1.40871 WP_002965789.1.41044 WP_002965789.1.41311 WP_002965789.1.41835 WP_002965789.1.41950 WP_002965789.1.4207 WP_002965789.1.42103 WP_002965789.1.42427 WP_002965789.1.43359 WP_002965789.1.43597 WP_002965789.1.4428 WP_002965789.1.44793 WP_002965789.1.45559 WP_002965789.1.46182 WP_002965789.1.46432 WP_002965789.1.4727 WP_002965789.1.47558 WP_002965789.1.4847 WP_002965789.1.49640 WP_002965789.1.49953 WP_002965789.1.50051 WP_002965789.1.50053 WP_002965789.1.50282 WP_002965789.1.5052 WP_002965789.1.5236 WP_002965789.1.5307 WP_002965789.1.53128 WP_002965789.1.53481 WP_002965789.1.5394 WP_002965789.1.54440 WP_002965789.1.54776 WP_002965789.1.54779 WP_002965789.1.55440 WP_002965789.1.55684 WP_002965789.1.56334 WP_002965789.1.56683 WP_002965789.1.56952 WP_002965789.1.57925 WP_002965789.1.58525 WP_002965789.1.58539 WP_002965789.1.59086 WP_002965789.1.59515 WP_002965789.1.59985 WP_002965789.1.61325 WP_002965789.1.61536 WP_002965789.1.61811 WP_002965789.1.61997 WP_002965789.1.63730 WP_002965789.1.64013 WP_002965789.1.64124 WP_002965789.1.64853 WP_002965789.1.64883 WP_002965789.1.64905 WP_002965789.1.65131 WP_002965789.1.65454 WP_002965789.1.6555 WP_002965789.1.65625 WP_002965789.1.66260 WP_002965789.1.66810 WP_002965789.1.67893 WP_002965789.1.67996 WP_002965789.1.67997 WP_002965789.1.68913 WP_002965789.1.69451 WP_002965789.1.69829 WP_002965789.1.70296 WP_002965789.1.70322 WP_002965789.1.71194 WP_002965789.1.71689 WP_002965789.1.71846 WP_002965789.1.7206 WP_002965789.1.72916 WP_002965789.1.7410 WP_002965789.1.75434 WP_002965789.1.75458 WP_002965789.1.75766 WP_002965789.1.76350 WP_002965789.1.76433 WP_002965789.1.77321 WP_002965789.1.78109 WP_002965789.1.78821 WP_002965789.1.79963 WP_002965789.1.8012 WP_002965789.1.80266 WP_002965789.1.80476 WP_002965789.1.80697 WP_002965789.1.81617 WP_002965789.1.81822 WP_002965789.1.82113 WP_002965789.1.8224 WP_002965789.1.82595 WP_002965789.1.8278 WP_002965789.1.85322 WP_002965789.1.85769 WP_002965789.1.8657 WP_002965789.1.87522 WP_002965789.1.87603 WP_002965789.1.87867 WP_002965789.1.8788 WP_002965789.1.8878 WP_002965789.1.90027 WP_002965789.1.90689 WP_002965789.1.91123 WP_002965789.1.91338 WP_002965789.1.91710 WP_002965789.1.92518 WP_002965789.1.9303 WP_002965789.1.93230 WP_002965789.1.93454 WP_002965789.1.93795 WP_002965789.1.94126 WP_002965789.1.94555 WP_002965789.1.94843 WP_002965789.1.95148 WP_002965789.1.97511 WP_002965789.1.98076 WP_002965789.1.98455 WP_002965789.1.99221 WP_002965789.1.99421 gi|62317312|ref|YP_223165.1| gi|560148417|ref|YP_008841212.1| gi|376270932|ref|YP_005113977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]