SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83269484|ref|YP_418775.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83269484|ref|YP_418775.1|
Domain Number 1 Region: 24-370
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.91e-79
Family L-arabinose binding protein-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83269484|ref|YP_418775.1|
Sequence length 390
Comment Leu/Ile/Val-binding family protein [Brucella melitensis biovar Abortus 2308]
Sequence
MKKIALTALAVFSLAASAAYADVVKVGVIGPFSGPFALQGKNFKAGIDAYMAEHGNKVGD
DTVEVVYRDVPQADPAQSKALAQELVVKEGVQYLAGFYFTPDAMAVTPILKQGNVPMVVM
NAATSSIVTKSPYVVRTSFTTWQTSTPIARVALDKGVKKVISVVSDYGPGVDAENAFKAA
FTDAGGEVVEAIRMPLATNDFSPIMQRIKDSGAQGVFAFLPSGPTTFGFMKAYVDNGLKS
SGIQLFAPGDLTQESDLPALGENALGVLTTFHYAVSHDSPENRKFVEEARKAIGNPAELS
FPSVGAYDGMHVIYKMIEATGGKKDAAKAVEAVKGMEWVSPRGPVSIDPESRHITQNIYL
REVAKADDGTYYNKEIQTFEKQGDPGLKAQ
Download sequence
Identical sequences A0A0F6AUN7 A0A0M1WH16 A0A2K4NPI7 Q2YKQ9 Q578E0
WP_002965989.1.100443 WP_002965989.1.102082 WP_002965989.1.10322 WP_002965989.1.10630 WP_002965989.1.10893 WP_002965989.1.11620 WP_002965989.1.12041 WP_002965989.1.12241 WP_002965989.1.13460 WP_002965989.1.13826 WP_002965989.1.14542 WP_002965989.1.14633 WP_002965989.1.15077 WP_002965989.1.16975 WP_002965989.1.17378 WP_002965989.1.18034 WP_002965989.1.19641 WP_002965989.1.20012 WP_002965989.1.22583 WP_002965989.1.2337 WP_002965989.1.24196 WP_002965989.1.24428 WP_002965989.1.24655 WP_002965989.1.24726 WP_002965989.1.25101 WP_002965989.1.25382 WP_002965989.1.25729 WP_002965989.1.26599 WP_002965989.1.2778 WP_002965989.1.2839 WP_002965989.1.2874 WP_002965989.1.2877 WP_002965989.1.28889 WP_002965989.1.31239 WP_002965989.1.32337 WP_002965989.1.32492 WP_002965989.1.32731 WP_002965989.1.33220 WP_002965989.1.33599 WP_002965989.1.33753 WP_002965989.1.34353 WP_002965989.1.35056 WP_002965989.1.35970 WP_002965989.1.37797 WP_002965989.1.38353 WP_002965989.1.39021 WP_002965989.1.39039 WP_002965989.1.39963 WP_002965989.1.40407 WP_002965989.1.40624 WP_002965989.1.40649 WP_002965989.1.40871 WP_002965989.1.41044 WP_002965989.1.41311 WP_002965989.1.42103 WP_002965989.1.42427 WP_002965989.1.43597 WP_002965989.1.4428 WP_002965989.1.45559 WP_002965989.1.46182 WP_002965989.1.46432 WP_002965989.1.4727 WP_002965989.1.47558 WP_002965989.1.47610 WP_002965989.1.4847 WP_002965989.1.49640 WP_002965989.1.50051 WP_002965989.1.50053 WP_002965989.1.50282 WP_002965989.1.5052 WP_002965989.1.5236 WP_002965989.1.53128 WP_002965989.1.53481 WP_002965989.1.5394 WP_002965989.1.54440 WP_002965989.1.55440 WP_002965989.1.55684 WP_002965989.1.56334 WP_002965989.1.56952 WP_002965989.1.57925 WP_002965989.1.58525 WP_002965989.1.58539 WP_002965989.1.59086 WP_002965989.1.59515 WP_002965989.1.61325 WP_002965989.1.61536 WP_002965989.1.61811 WP_002965989.1.61997 WP_002965989.1.63730 WP_002965989.1.64124 WP_002965989.1.64853 WP_002965989.1.64905 WP_002965989.1.65131 WP_002965989.1.65454 WP_002965989.1.65625 WP_002965989.1.66260 WP_002965989.1.66810 WP_002965989.1.67893 WP_002965989.1.67996 WP_002965989.1.67997 WP_002965989.1.68913 WP_002965989.1.69829 WP_002965989.1.70322 WP_002965989.1.71194 WP_002965989.1.71689 WP_002965989.1.71846 WP_002965989.1.7206 WP_002965989.1.72916 WP_002965989.1.75458 WP_002965989.1.75766 WP_002965989.1.76350 WP_002965989.1.76433 WP_002965989.1.77321 WP_002965989.1.78109 WP_002965989.1.7984 WP_002965989.1.79963 WP_002965989.1.80266 WP_002965989.1.80476 WP_002965989.1.80697 WP_002965989.1.81822 WP_002965989.1.8224 WP_002965989.1.8278 WP_002965989.1.8307 WP_002965989.1.85322 WP_002965989.1.85769 WP_002965989.1.8657 WP_002965989.1.87522 WP_002965989.1.87603 WP_002965989.1.87867 WP_002965989.1.8788 WP_002965989.1.8878 WP_002965989.1.90689 WP_002965989.1.91123 WP_002965989.1.91338 WP_002965989.1.92518 WP_002965989.1.93454 WP_002965989.1.94126 WP_002965989.1.94555 WP_002965989.1.94775 WP_002965989.1.97511 WP_002965989.1.97741 WP_002965989.1.98076 WP_002965989.1.98455 WP_002965989.1.99221 WP_002965989.1.99421 gi|376271138|ref|YP_005114183.1| gi|189022755|ref|YP_001932496.1| gi|62317502|ref|YP_223355.1| 262698.BruAb2_0578 359391.BAB2_0593 430066.BAbS19_II05550 gi|83269484|ref|YP_418775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]