SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83269557|ref|YP_418848.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|83269557|ref|YP_418848.1|
Domain Number - Region: 173-220
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000118
Family L-arabinose binding protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83269557|ref|YP_418848.1|
Sequence length 350
Comment basic membrane lipoprotein [Brucella melitensis biovar Abortus 2308]
Sequence
MVIATVAGFMLGGAAHAEEKLKVGFIYIGPPGDFGWTYQHDQARKELVEALGDKVETTFL
ENVAEGADAERSIKRIARAGNKLIFTTSFGYMDPTVKVAKKFPDVKFEHATGYKTADNMS
AYNARFYEGRYVQGVIAAKMSKKGIAGYIGSVPVPEVVQGINSFMLGAQSVNPDFRVKVI
WVNSWFDPGKEADAAKALIDQGVDIITQHTDSTAAIQVAHDRGIKAFGQASDMIKFAPDT
QLTAVVDEWGPYYIDRAKAVLDGTWKSQNIWWGMKEGLVKMAPFTNMPDDVKKLAEETEA
RIKSGELNPFTGPIKKQDGSEWLKAGEKADDQTLLGMNFYVAGVDDKLPQ
Download sequence
Identical sequences A0A0F6AUV2 A0A0M1WH63 A0A2K4NPQ3 Q2YKI6 Q577W7
WP_002966067.1.14542 WP_002966067.1.17378 WP_002966067.1.18034 WP_002966067.1.25101 WP_002966067.1.25729 WP_002966067.1.2877 WP_002966067.1.33220 WP_002966067.1.34353 WP_002966067.1.39021 WP_002966067.1.4847 WP_002966067.1.49640 WP_002966067.1.58525 WP_002966067.1.59515 WP_002966067.1.75766 WP_002966067.1.85322 WP_002966067.1.99221 gi|189022830|ref|YP_001932571.1| gi|376271217|ref|YP_005114262.1| gi|62317575|ref|YP_223428.1| gi|83269557|ref|YP_418848.1| 262698.BruAb2_0657 359391.BAB2_0673 430066.BAbS19_II06300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]