SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83269693|ref|YP_418984.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83269693|ref|YP_418984.1|
Domain Number 1 Region: 27-390
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.03e-68
Family L-arabinose binding protein-like 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83269693|ref|YP_418984.1|
Sequence length 403
Comment Leu/Ile/Val-binding family protein [Brucella melitensis biovar Abortus 2308]
Sequence
MRLSRLLIGASLGVALSSTVFTAALADVKFGSLYPISGSLALLGEESARGLELAVDEVNA
AGGIKGEKVVLERGDAVDNNQATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIP
YFEMGAVADEVTGRGLQYLFRTNPTAENMAKDSVDMLIKGIAPGLGKDPKDMKIGIIYED
SSYGTSVAGHQEDNAKAAGLTVVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSV
LFLQQANEAGYKPLAIIGGGGGYSMQPTADAVGHDLIDGVFDADYTQYAVNTSATPGLTE
FVEAYKAKYGSQPRSGHSLTNYVGAKAIFQALNAGEGFEPDQIVSAVKALDIPDGQTAAG
YGVKFGKNNQNERATMMGMQWQDGKLVTVYPENAAIAKMRFKK
Download sequence
Identical sequences A0A0F6AV85 A0A0M1WHZ6 A0A2D3KAD3 A0A2I7WVV7 C0RKU2 D7H4P0 Q2YK50 Q577I2
gi|384212900|ref|YP_005601983.1| WP_002966215.1.100443 WP_002966215.1.100628 WP_002966215.1.100807 WP_002966215.1.101411 WP_002966215.1.101965 WP_002966215.1.102026 WP_002966215.1.102082 WP_002966215.1.10322 WP_002966215.1.1055 WP_002966215.1.10630 WP_002966215.1.10844 WP_002966215.1.10866 WP_002966215.1.10893 WP_002966215.1.11066 WP_002966215.1.11620 WP_002966215.1.11859 WP_002966215.1.11933 WP_002966215.1.12041 WP_002966215.1.12241 WP_002966215.1.12704 WP_002966215.1.12925 WP_002966215.1.12981 WP_002966215.1.1327 WP_002966215.1.13460 WP_002966215.1.13826 WP_002966215.1.14323 WP_002966215.1.14542 WP_002966215.1.14633 WP_002966215.1.15077 WP_002966215.1.16975 WP_002966215.1.17378 WP_002966215.1.18034 WP_002966215.1.18494 WP_002966215.1.18635 WP_002966215.1.19483 WP_002966215.1.19508 WP_002966215.1.19641 WP_002966215.1.20012 WP_002966215.1.20317 WP_002966215.1.22142 WP_002966215.1.22583 WP_002966215.1.2337 WP_002966215.1.24196 WP_002966215.1.24428 WP_002966215.1.24607 WP_002966215.1.24655 WP_002966215.1.24726 WP_002966215.1.24895 WP_002966215.1.24923 WP_002966215.1.24971 WP_002966215.1.25101 WP_002966215.1.25135 WP_002966215.1.25382 WP_002966215.1.25450 WP_002966215.1.25729 WP_002966215.1.26599 WP_002966215.1.2778 WP_002966215.1.27794 WP_002966215.1.2839 WP_002966215.1.2874 WP_002966215.1.2877 WP_002966215.1.28889 WP_002966215.1.29765 WP_002966215.1.29997 WP_002966215.1.31094 WP_002966215.1.31106 WP_002966215.1.31239 WP_002966215.1.31635 WP_002966215.1.31644 WP_002966215.1.31680 WP_002966215.1.32337 WP_002966215.1.32492 WP_002966215.1.32731 WP_002966215.1.32779 WP_002966215.1.33032 WP_002966215.1.33220 WP_002966215.1.33289 WP_002966215.1.33466 WP_002966215.1.33599 WP_002966215.1.33753 WP_002966215.1.34183 WP_002966215.1.34353 WP_002966215.1.34423 WP_002966215.1.35056 WP_002966215.1.35338 WP_002966215.1.35577 WP_002966215.1.35970 WP_002966215.1.36149 WP_002966215.1.36712 WP_002966215.1.37797 WP_002966215.1.38353 WP_002966215.1.39021 WP_002966215.1.39039 WP_002966215.1.39963 WP_002966215.1.40189 WP_002966215.1.40407 WP_002966215.1.40624 WP_002966215.1.40649 WP_002966215.1.40871 WP_002966215.1.4091 WP_002966215.1.41044 WP_002966215.1.41105 WP_002966215.1.41311 WP_002966215.1.41344 WP_002966215.1.41835 WP_002966215.1.42065 WP_002966215.1.42103 WP_002966215.1.42427 WP_002966215.1.42633 WP_002966215.1.42774 WP_002966215.1.4295 WP_002966215.1.43058 WP_002966215.1.43148 WP_002966215.1.4319 WP_002966215.1.43597 WP_002966215.1.44045 WP_002966215.1.44060 WP_002966215.1.4428 WP_002966215.1.44541 WP_002966215.1.45559 WP_002966215.1.46182 WP_002966215.1.46432 WP_002966215.1.4727 WP_002966215.1.47558 WP_002966215.1.47610 WP_002966215.1.48075 WP_002966215.1.48184 WP_002966215.1.4847 WP_002966215.1.50051 WP_002966215.1.50053 WP_002966215.1.50282 WP_002966215.1.5052 WP_002966215.1.50924 WP_002966215.1.51553 WP_002966215.1.5236 WP_002966215.1.52478 WP_002966215.1.52541 WP_002966215.1.53128 WP_002966215.1.53481 WP_002966215.1.5394 WP_002966215.1.54440 WP_002966215.1.54481 WP_002966215.1.54776 WP_002966215.1.54779 WP_002966215.1.55047 WP_002966215.1.55284 WP_002966215.1.55440 WP_002966215.1.55684 WP_002966215.1.56334 WP_002966215.1.56621 WP_002966215.1.56683 WP_002966215.1.56952 WP_002966215.1.57541 WP_002966215.1.57925 WP_002966215.1.58525 WP_002966215.1.58539 WP_002966215.1.59086 WP_002966215.1.59515 WP_002966215.1.60134 WP_002966215.1.60920 WP_002966215.1.61081 WP_002966215.1.61325 WP_002966215.1.61536 WP_002966215.1.61543 WP_002966215.1.61811 WP_002966215.1.61961 WP_002966215.1.61997 WP_002966215.1.63730 WP_002966215.1.64013 WP_002966215.1.64124 WP_002966215.1.6440 WP_002966215.1.64585 WP_002966215.1.64853 WP_002966215.1.64883 WP_002966215.1.64905 WP_002966215.1.65131 WP_002966215.1.65454 WP_002966215.1.65501 WP_002966215.1.6555 WP_002966215.1.65597 WP_002966215.1.65625 WP_002966215.1.66078 WP_002966215.1.66260 WP_002966215.1.66268 WP_002966215.1.66407 WP_002966215.1.66647 WP_002966215.1.66810 WP_002966215.1.66855 WP_002966215.1.67107 WP_002966215.1.67659 WP_002966215.1.67893 WP_002966215.1.67996 WP_002966215.1.67997 WP_002966215.1.68913 WP_002966215.1.69451 WP_002966215.1.69829 WP_002966215.1.69997 WP_002966215.1.70160 WP_002966215.1.70322 WP_002966215.1.70760 WP_002966215.1.71194 WP_002966215.1.71228 WP_002966215.1.71689 WP_002966215.1.71846 WP_002966215.1.7206 WP_002966215.1.72189 WP_002966215.1.72916 WP_002966215.1.73628 WP_002966215.1.73739 WP_002966215.1.7388 WP_002966215.1.74236 WP_002966215.1.75128 WP_002966215.1.75434 WP_002966215.1.75458 WP_002966215.1.75563 WP_002966215.1.75766 WP_002966215.1.76350 WP_002966215.1.76433 WP_002966215.1.7667 WP_002966215.1.76877 WP_002966215.1.77281 WP_002966215.1.77321 WP_002966215.1.77685 WP_002966215.1.77899 WP_002966215.1.78109 WP_002966215.1.78821 WP_002966215.1.79327 WP_002966215.1.79963 WP_002966215.1.79993 WP_002966215.1.80167 WP_002966215.1.80266 WP_002966215.1.80476 WP_002966215.1.80697 WP_002966215.1.81377 WP_002966215.1.81617 WP_002966215.1.81822 WP_002966215.1.82113 WP_002966215.1.82205 WP_002966215.1.8224 WP_002966215.1.82390 WP_002966215.1.82753 WP_002966215.1.8278 WP_002966215.1.82834 WP_002966215.1.82990 WP_002966215.1.8307 WP_002966215.1.84601 WP_002966215.1.84764 WP_002966215.1.85322 WP_002966215.1.85684 WP_002966215.1.85753 WP_002966215.1.85769 WP_002966215.1.8657 WP_002966215.1.86832 WP_002966215.1.86901 WP_002966215.1.87522 WP_002966215.1.87603 WP_002966215.1.87867 WP_002966215.1.8788 WP_002966215.1.88658 WP_002966215.1.8878 WP_002966215.1.88867 WP_002966215.1.89113 WP_002966215.1.90689 WP_002966215.1.9096 WP_002966215.1.91081 WP_002966215.1.91123 WP_002966215.1.91338 WP_002966215.1.91710 WP_002966215.1.92383 WP_002966215.1.92518 WP_002966215.1.93454 WP_002966215.1.93795 WP_002966215.1.94126 WP_002966215.1.94555 WP_002966215.1.94775 WP_002966215.1.95141 WP_002966215.1.95178 WP_002966215.1.95770 WP_002966215.1.96661 WP_002966215.1.96710 WP_002966215.1.97320 WP_002966215.1.97331 WP_002966215.1.97511 WP_002966215.1.97741 WP_002966215.1.97860 WP_002966215.1.98076 WP_002966215.1.98455 WP_002966215.1.98764 WP_002966215.1.99221 WP_002966215.1.99373 WP_002966215.1.99421 262698.BruAb2_0809 359391.BAB2_0830 430066.BAbS19_II07690 546272.BMEA_B0373 gi|225686207|ref|YP_002734179.1| gi|384410002|ref|YP_005598622.1| gi|384446527|ref|YP_005660745.1| gi|83269693|ref|YP_418984.1| gi|62317710|ref|YP_223563.1| gi|376271369|ref|YP_005114414.1| gi|189022967|ref|YP_001932708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]