SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83269945|ref|YP_419236.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83269945|ref|YP_419236.1|
Domain Number 1 Region: 34-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.86e-72
Family L-arabinose binding protein-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83269945|ref|YP_419236.1|
Sequence length 339
Comment LacI transcriptional regulator [Brucella melitensis biovar Abortus 2308]
Sequence
MKRRNFLAGALVAAALGIGAMGATPAFASPEHPVIGFSIDDLRVERWARDRDYFIAAAEK
LGAKVNVQSADGNEEKQVKQVENLISQGVDAIVIVPMNSKVFDAVVADAKASGIKVLSYD
RLILNADIDAYISFDNERVGFMQAQAVLKAKPEGNYYLLGGSPTDNNAKLLRAGQEKALK
EAVDSGKVKIVGSQWVKEWSPTEALSIMENALTATQNKIDAVVASNDGTAGGAIQALAAQ
GLAGKTAVSGQDSDLAAVKRLVDGTQTVTVYKPLKLIAEEAAKLTVQMVRDEKPEFNGKI
NNGSKDVDTLLLTPTAVTKDNIDIYIKDGFYTKEQIEGK
Download sequence
Identical sequences A0A0E1WXT9 A0A0F6AVW8 A0A0H3GC09 A0A0M1WF78 A0A1P8S7F5 A0A2D2BVA8 A0A2I7WWJ9 A9MD70 C7LJR8 D0RCX9 D7H5S1 Q2YJE8 Q576H4
gi|189023219|ref|YP_001932960.1| gi|376279086|ref|YP_005109119.1| gi|23500864|ref|NP_700304.1| gi|340792906|ref|YP_004758370.1| gi|560148179|ref|YP_008840974.1| gi|161621192|ref|YP_001595078.1| gi|376277341|ref|YP_005153402.1| gi|62317968|ref|YP_223821.1| 204722.BRA1150 262698.BruAb2_1087 359391.BAB2_1109 430066.BAbS19_II10340 483179.BCAN_B1179 568815.BMI_II1156 gi|560150635|ref|YP_008843428.1| gi|256015909|ref|YP_003105918.1| WP_002966632.1.100018 WP_002966632.1.100443 WP_002966632.1.101965 WP_002966632.1.102082 WP_002966632.1.10307 WP_002966632.1.10322 WP_002966632.1.10630 WP_002966632.1.10893 WP_002966632.1.11620 WP_002966632.1.12041 WP_002966632.1.12241 WP_002966632.1.13020 WP_002966632.1.13460 WP_002966632.1.13592 WP_002966632.1.13826 WP_002966632.1.14542 WP_002966632.1.14633 WP_002966632.1.15077 WP_002966632.1.15325 WP_002966632.1.16733 WP_002966632.1.16975 WP_002966632.1.17378 WP_002966632.1.1800 WP_002966632.1.18034 WP_002966632.1.18635 WP_002966632.1.19508 WP_002966632.1.19641 WP_002966632.1.19645 WP_002966632.1.20012 WP_002966632.1.20317 WP_002966632.1.22340 WP_002966632.1.22583 WP_002966632.1.2337 WP_002966632.1.24196 WP_002966632.1.24428 WP_002966632.1.24655 WP_002966632.1.24726 WP_002966632.1.2483 WP_002966632.1.25101 WP_002966632.1.25382 WP_002966632.1.25561 WP_002966632.1.25729 WP_002966632.1.26599 WP_002966632.1.27052 WP_002966632.1.2778 WP_002966632.1.2839 WP_002966632.1.2874 WP_002966632.1.2877 WP_002966632.1.28889 WP_002966632.1.29336 WP_002966632.1.31239 WP_002966632.1.31463 WP_002966632.1.32337 WP_002966632.1.32492 WP_002966632.1.32731 WP_002966632.1.33220 WP_002966632.1.33599 WP_002966632.1.33753 WP_002966632.1.3390 WP_002966632.1.34225 WP_002966632.1.34353 WP_002966632.1.35056 WP_002966632.1.3681 WP_002966632.1.37797 WP_002966632.1.38343 WP_002966632.1.38353 WP_002966632.1.38790 WP_002966632.1.38925 WP_002966632.1.39021 WP_002966632.1.39039 WP_002966632.1.39963 WP_002966632.1.40138 WP_002966632.1.40407 WP_002966632.1.40624 WP_002966632.1.40649 WP_002966632.1.408 WP_002966632.1.40871 WP_002966632.1.41044 WP_002966632.1.41311 WP_002966632.1.41941 WP_002966632.1.41950 WP_002966632.1.42071 WP_002966632.1.42103 WP_002966632.1.42427 WP_002966632.1.43006 WP_002966632.1.43359 WP_002966632.1.43583 WP_002966632.1.43597 WP_002966632.1.43689 WP_002966632.1.43928 WP_002966632.1.4428 WP_002966632.1.44294 WP_002966632.1.44793 WP_002966632.1.44989 WP_002966632.1.45559 WP_002966632.1.46182 WP_002966632.1.46432 WP_002966632.1.4727 WP_002966632.1.47558 WP_002966632.1.47610 WP_002966632.1.4847 WP_002966632.1.48744 WP_002966632.1.49542 WP_002966632.1.49640 WP_002966632.1.49753 WP_002966632.1.49953 WP_002966632.1.50051 WP_002966632.1.50053 WP_002966632.1.50282 WP_002966632.1.5052 WP_002966632.1.52027 WP_002966632.1.5236 WP_002966632.1.5307 WP_002966632.1.53128 WP_002966632.1.53481 WP_002966632.1.5394 WP_002966632.1.54440 WP_002966632.1.54776 WP_002966632.1.55440 WP_002966632.1.55684 WP_002966632.1.56313 WP_002966632.1.56334 WP_002966632.1.56952 WP_002966632.1.57564 WP_002966632.1.57925 WP_002966632.1.58260 WP_002966632.1.58525 WP_002966632.1.58539 WP_002966632.1.58868 WP_002966632.1.59086 WP_002966632.1.59091 WP_002966632.1.59515 WP_002966632.1.5971 WP_002966632.1.59985 WP_002966632.1.60631 WP_002966632.1.61325 WP_002966632.1.61536 WP_002966632.1.61811 WP_002966632.1.61997 WP_002966632.1.62592 WP_002966632.1.63730 WP_002966632.1.63732 WP_002966632.1.64013 WP_002966632.1.64124 WP_002966632.1.64849 WP_002966632.1.64853 WP_002966632.1.64905 WP_002966632.1.65131 WP_002966632.1.65299 WP_002966632.1.65454 WP_002966632.1.6555 WP_002966632.1.65625 WP_002966632.1.65651 WP_002966632.1.66078 WP_002966632.1.66260 WP_002966632.1.66810 WP_002966632.1.67893 WP_002966632.1.67996 WP_002966632.1.67997 WP_002966632.1.68488 WP_002966632.1.68913 WP_002966632.1.69451 WP_002966632.1.69829 WP_002966632.1.70296 WP_002966632.1.70322 WP_002966632.1.71002 WP_002966632.1.71194 WP_002966632.1.71689 WP_002966632.1.71846 WP_002966632.1.7206 WP_002966632.1.72439 WP_002966632.1.72916 WP_002966632.1.75434 WP_002966632.1.75458 WP_002966632.1.75766 WP_002966632.1.76350 WP_002966632.1.76433 WP_002966632.1.77321 WP_002966632.1.77899 WP_002966632.1.78109 WP_002966632.1.78716 WP_002966632.1.78821 WP_002966632.1.7984 WP_002966632.1.79963 WP_002966632.1.8012 WP_002966632.1.80266 WP_002966632.1.80365 WP_002966632.1.80476 WP_002966632.1.80697 WP_002966632.1.81558 WP_002966632.1.81617 WP_002966632.1.81822 WP_002966632.1.82113 WP_002966632.1.8223 WP_002966632.1.8224 WP_002966632.1.82448 WP_002966632.1.8278 WP_002966632.1.8307 WP_002966632.1.83513 WP_002966632.1.85322 WP_002966632.1.85721 WP_002966632.1.85769 WP_002966632.1.8657 WP_002966632.1.87522 WP_002966632.1.87603 WP_002966632.1.87867 WP_002966632.1.8788 WP_002966632.1.88404 WP_002966632.1.8878 WP_002966632.1.90027 WP_002966632.1.90689 WP_002966632.1.91123 WP_002966632.1.91338 WP_002966632.1.91710 WP_002966632.1.91958 WP_002966632.1.92518 WP_002966632.1.9303 WP_002966632.1.93230 WP_002966632.1.93367 WP_002966632.1.93454 WP_002966632.1.94126 WP_002966632.1.94555 WP_002966632.1.94775 WP_002966632.1.95148 WP_002966632.1.97511 WP_002966632.1.97741 WP_002966632.1.98076 WP_002966632.1.98362 WP_002966632.1.98455 WP_002966632.1.99221 WP_002966632.1.99373 WP_002966632.1.99421 gi|83269945|ref|YP_419236.1| gi|376270495|ref|YP_005113540.1| gi|23500864|ref|NP_700304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]